CAZyme Information: FOYG_02056-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_02056-t42_1-p1
• CAZy Family: AA7
• CAZyme Description: beta-glucuronidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
599		68075.59	5.3629

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717839.1:5214961-5216760(+)

Full Sequence      

MLKPQANASRELVSLDGVWNFALSQSVDIDDERAWERNIPPELQVPVPASYNDIFIDSNI
RNHVGWVYYQRRFTIPLSWSQQRYFLRFDAATHRGRVYVDNQFVAEHIGGYTPFEVDISD
IVQPGKQVRLTVAVNNELDWHTIPPGRIETLKNGKRKQHYQHDFFNYAGLARSVWLFTVP
SISVKDITVVTKVEGTTGVVDFNIATSIPLDHHSINVTLLDEDECPVSHSSELNGSLIVE
SAHLWQPGAAYLYQLRAEVFSGNTVVDTYDLPVGIRTVEVSGNKFLINGKPFYFTGFGKH
EDTPIRGKGHDPAYMIHDFQLMKWMGANSFRTSHYPYAEEVLEYADRHGIVVINETAAVG
LNLTIVAGLFGQKPIPTFSPETMNDETRAAHAQAIRELIARDKNHPSVVMWTIANEPAAS
EPGVREYMEPLVKLNRELDPTRPICFANENQANIHTDLIADLFDVICLNRYYGWDLNTGD
LEEAEQGLEECLRSWEGKYNKPIIMTEYGADTLAGLHTVGDIPWSEEYQSQVLEMSHRVF
DRIEGVVGEQVWNFADFQTPSSFIFRVDGNKKGVFTRDRRPKSAVQVLRKRWTQTIANN

Enzyme Prediction     

EC	3.2.1.31:89

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	590	1e-106	0.6143617021276596

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236657	PRK10150	0.0	1	593	1	593	beta-D-glucuronidase; Provisional
225789	LacZ	1.27e-127	1	596	1	599	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
397119	Glyco_hydro_2_C	4.06e-99	278	593	1	298	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236673	ebgA	1.80e-41	5	556	34	547	cryptic beta-D-galactosidase subunit alpha; Reviewed
397120	Glyco_hydro_2_N	3.48e-31	14	180	3	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD50402.1|GH2	0.0	1	599	1	599
UPK93312.1|GH2	0.0	1	599	1	598
AFM77719.1|GH2	0.0	1	594	1	594
QIM55348.1|GH2	1.18e-293	2	592	23	618
QPC73354.1|GH2	5.58e-292	1	596	1	602

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C70_A	4.55e-280	1	593	9	598	The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
5C71_A	9.14e-279	1	593	34	623	The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_B The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_C The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_D The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae]
6LEJ_B	7.51e-233	1	593	1	589	Chain B, Beta-D-glucuronidase [Escherichia coli]
6LEG_A	7.78e-233	1	593	2	590	Chain A, Beta-D-glucuronidase [Escherichia coli],6LEG_B Chain B, Beta-D-glucuronidase [Escherichia coli],6LEG_C Chain C, Beta-D-glucuronidase [Escherichia coli],6LEG_D Chain D, Beta-D-glucuronidase [Escherichia coli],6LEL_A Chain A, Beta-D-glucuronidase [Escherichia coli],6LEL_B Chain B, Beta-D-glucuronidase [Escherichia coli]
3K46_A	8.06e-233	1	593	3	591	Crystal structure of full-length E. coli beta-glucuronidase [Escherichia coli K-12],3K46_B Crystal structure of full-length E. coli beta-glucuronidase [Escherichia coli K-12],3K4D_A Crystal structure of E. coli beta-glucuronidase with the glucaro-d-lactam inhibitor bound [Escherichia coli K-12],3K4D_B Crystal structure of E. coli beta-glucuronidase with the glucaro-d-lactam inhibitor bound [Escherichia coli K-12],6LEM_A Chain A, Beta-D-glucuronidase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P05804|BGLR_ECOLI	3.87e-232	1	593	1	589	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
sp|P12265|BGLR_MOUSE	2.02e-162	1	598	27	627	Beta-glucuronidase OS=Mus musculus OX=10090 GN=Gusb PE=1 SV=2
sp|P06760|BGLR_RAT	1.82e-160	1	598	27	627	Beta-glucuronidase OS=Rattus norvegicus OX=10116 GN=Gusb PE=1 SV=1
sp|O97524|BGLR_FELCA	2.00e-160	1	592	27	625	Beta-glucuronidase OS=Felis catus OX=9685 GN=GUSB PE=1 SV=1
sp|O18835|BGLR_CANLF	9.01e-159	1	592	27	625	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999883	0.000162

TMHMM  Annotations     

There is no transmembrane helices in FOYG_02056-t42_1-p1.