CAZyme Information: FOYG_02004-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_02004-t42_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
448		50316.46	6.6313

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717839.1:5065526-5066989(+)

Full Sequence      

MRAFLIQTAKGLFSSSGGYKANNALLRYLSSRGHRVRQLCYSYRGEVEHYMQTLNSSGDY
DPRLDTRVLHMRLEDGKPGIDVKVHEICMDDGVETLALDSEAFDAAFGGKADSPNQLARM
SAEYIEKGTSSAPLMDFISFLQREIRRFSPTHIISNDGLSMKASLASELAHLTMSRIAVV
HTAEQLPFGPFAGGVPGHSSTTREADLFQQLDGICSVSDAIRNYALEQGQLQTRFLVHHP
WTYLVGKDHEMPSRLFNWDKKFVAMINPCPVKGSYIFVNLTRACPQLEFLTYMSWGADNA
TVKQMEDLPNMTIRPCCAKEKDLWRDIKVLIVPSLWCEAWGMVVVEAHLRGIPVVSSNSG
ALSESMLGLDYIIPVNPISGERDESGRYTVPEQDVEPWVKAITKLMQDRPEYERVSATVR
NKTKEWLKGNNEASIETWLMGMRTGSKF

Enzyme Prediction     

No EC number prediction in FOYG_02004-t42_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340850	GT4_ExpE7-like	4.12e-20	140	424	87	343	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
340831	GT4_PimA-like	2.15e-10	321	425	262	350	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
404563	Glyco_trans_1_4	7.94e-09	322	408	69	138	Glycosyl transferases group 1.
223515	RfaB	1.18e-08	133	425	69	359	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
395425	Glycos_transf_1	1.24e-08	321	422	73	158	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD50346.1|GT4	7.97e-309	1	446	1	446
CAE6996711.1|GT4	3.06e-200	1	442	30	471
CAE85589.1|GT4	5.38e-110	1	444	24	461
AEO58675.1|GT4	6.11e-107	1	442	12	417
AEO63904.1|GT4	3.92e-106	1	442	2	410

PDB Hits     

FOYG_02004-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

FOYG_02004-t42_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOYG_02004-t42_1-p1.