CAZyme Information: FOYG_01560-t42_3-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_01560-t42_3-p1
• CAZy Family: AA4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		41772.32	7.8297

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717839.1:3973255-3974497(-)

Full Sequence      

MSRYSSGVKPGEIPPIYDEIMLARKGQEVRHASSTMPWWNPRYWRKRVWAAIIIVIIVIV
IIIVAVAVGKARKNIYPDYTPLSYSLKDTCKCLSSSARMKRPANHCPDGGESFFDQFNYF
TGYDPTEGFVHYVPKAQAELLNLTYASPSTAVIKVDTSVGPNDKPNASTGRFSVRIESKK
TYENGLFIFDVKHTPYGCGTWPALWLTDPFNWPNHGEIDVMESTNKAEDGNQMTLHTTGD
CSMDVRREDTGKTLQKNCNHEKDDNAGCGVLSEPAGYGTVFNKNGGGVMAVEWRHEGIRM
WQFGRDSIPSDIKGNNPKPDTWGTAVADFPNTHCNIGTHFKNQSIIANIDLCGSLVYHVW
DNSGCKLAHILVRK

Enzyme Prediction     

No EC number prediction in FOYG_01560-t42_3-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	142	367	9.5e-86	0.9606986899563319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185690	GH16_fungal_Lam16A_glucanase	6.04e-119	110	366	10	262	fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Group of fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Lam16A belongs to the 'nonspecific' 1,3(4)-beta-glucanase subfamily, although beta-1,6 branching and beta-1,4 bonds specifically define where Lam16A hydrolyzes its substrates, like curdlan (beta-1,3-glucan), lichenin (beta-1,3-1,4-mixed linkage glucan), and laminarin (beta-1,6-branched-1,3-glucan).
185693	GH16_laminarinase_like	1.89e-09	161	242	53	140	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
395585	Glyco_hydro_16	6.90e-06	171	240	20	86	Glycosyl hydrolases family 16.
185691	GH16_Strep_laminarinase_like	3.80e-04	199	236	106	148	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
185683	Glyco_hydrolase_16	0.006	142	254	31	136	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD49943.1|GH16_1	8.35e-257	1	366	1	348
CCT67128.1|GH16_1	3.54e-242	1	366	1	348
QGI63164.1|GH16_1	1.44e-241	1	366	1	348
QGI94048.1|GH16_1	1.44e-241	1	366	1	348
QGI80331.1|GH16_1	1.25e-228	1	366	1	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2CL2_A	1.68e-63	110	365	11	269	Chain A, PUTATIVE LAMINARINASE [Phanerodontia chrysosporium],2W39_A Chain A, Putative Laminarinase [Phanerodontia chrysosporium],2W52_A Chain A, PUTATIVE LAMINARINASE [Phanerodontia chrysosporium]
2WLQ_A	9.35e-63	110	365	11	269	Chain A, PUTATIVE LAMINARINASE [Phanerodontia chrysosporium],2WNE_A Chain A, PUTATIVE LAMINARINASE [Phanerodontia chrysosporium]
3WDU_A	2.52e-55	110	365	11	264	The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_B The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_C The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_D The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila']
3WDT_A	2.59e-55	110	365	12	265	The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_B The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_C The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_D The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDV_A The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_B The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_C The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_D The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDY_A	1.90e-54	110	365	10	263	The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_B The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_C The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_D The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila']

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9USW3|YHZ7_SCHPO	1.38e-67	110	365	137	389	Probable glycosidase C21B10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC21B10.07 PE=3 SV=1
sp|Q2UIE6|EGLX_ASPOR	1.22e-52	110	368	39	292	Probable endo-1,3(4)-beta-glucanase AO090023000083 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000083 PE=3 SV=1
sp|B8N7S7|EGLX_ASPFN	1.69e-52	110	368	39	292	Probable endo-1,3(4)-beta-glucanase AFLA_105200 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=AFLA_105200 PE=3 SV=1
sp|D4AJR9|EGLX_ARTBC	7.45e-51	112	360	30	277	Endo-1,3(4)-beta-glucanase ARB_04519 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04519 PE=3 SV=1
sp|A2QBQ3|EGLX_ASPNC	4.45e-49	110	368	35	287	Probable endo-1,3(4)-beta-glucanase An02g00850 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g00850 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999997	0.000039

TMHMM  Annotations     

Start	End
47	69