CAZyme Information: FOYG_00920-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_00920-t42_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1408		154995.68	4.7362

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717839.1:2259152-2264306(-)

Full Sequence      

MSMNNIFARETTDFFNPDDLSWIDKLAAIGDSYSAGIGAGDGLHGEGDENCRRYDHSYPY
LINQDERLGDPSKRNFQFKSCSGAVIRNVIEDQLPSIDSDQQIILLSAGGNDAELVNILN
QCVYQWFALKDQHSTVGKVAEMKGEPWAKDWDWDAASRGCLGQLQYSKNIINSDEFSQRI
DSVIEATKKKLSTEGMIYYTGYAKFWSTDYGSACDKVSWSTWLFKSYNIWQPVARLEELR
RREMNRLVDLINDKIEAAVKRAGDKVSFVNYDKYVGHFKGRYCEDGVDESVVDSNTRPEL
MFYELDTFDPWGNRPWKRSTVEHKNGSFSGDMNMMARAAEFVAPDVTFRQEHKIEETSEI
QGLQAAAEEGATEDVPNLLPDGYDRVFHPQILLHELIANLVLFQISNRRMEENKMAPEPL
LDTSVAQCPINPSGNIVLKYKEIEPGEAVKKDTELRILPVGDSITVGYLSDREGGDGNGY
RGQLKKDLSGDKAVFAGTESSGTMTDGYYAAWSGKTIQYISDHVDPSLKQRPNIILLAAG
TNDMNPNHGISKEGNDPKGAADRLGKLIDKMVKACPDATILVAIIINTCDERQSPATKEF
QKLVPDVVRSRHDDGKHVLAVDFTTFKTSDLQDCIHPTNDGYRLMGDYWYSFIHQIPNSW
IKKPVGPDPNGGDSTNGGIDKSIPAPDWGKSPIQVTSKKTVADAAKYATGGKDKYVTCNG
NPWYKATGKIAQGGVGKNGDWQYHKDWKAEGQVAEGLGLDNQYVRLHDMNGDGKADYVWI
HPKTGEITCWLNNLPKPWSKAGNDNGIIGSGVGPAKTIYLADMNGDGMDDYLVVDPDNGS
VRVWWNYGPDDGWDNGWKFVPGGEIASGVPHANLETLRFPDINGDGRADYVYIGEGGSLK
HHLNTGSVGGRDVLFHAMGGIATGAVSDISKLMFADMNGDGRDDYLIWDEDGGLTGFLNQ
PTNREGVPLFVNQGPAKTIADGIKKKPSTIRLADMDGDGKDDYVYIGDHGALSVWYNRGT
TGDSMAIDGLRFADMDGDGVDDYVWLDPKTGAPTVYLNSGVNDGDSLGWAWKPINGGKPI
ASGAAPASQVVFGDINGDGLDDYLDLDPKTGLLKAYLNLGGESEWKFRPIGTIASGLGPG
KRVRIADIDGDGRDDYIFLKDNGGTTIYRNIYGPDNDGDKYAPMPDADASGINQSPEEID
FIDMNGDGKADYVWTSRLDGSVKVWYNDYPKKPTWREAGEIAGGVGTSGSNIRYAKLQKT
GRYDYVAVDPKTGAIGAWLNGCGDPDTSKKKHRITIARYLVTVWVIAEKPVDKDWSSDTC
FKTGKDGDTRGTPVLKTTADDKFPAALRSGDTMEKLYGHTCFYEGSTERVGKLVCDGVSG
IRCYEDENFGKTQKCRFGSYTYALYCEW

Enzyme Prediction     

No EC number prediction in FOYG_00920-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	455	653	6.6e-46	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	8.94e-49	455	653	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238861	SEST_like	3.71e-30	25	301	2	238	SEST_like. A family of secreted SGNH-hydrolases similar to Streptomyces scabies esterase (SEST), a causal agent of the potato scab disease, which hydrolyzes a specific ester bond in suberin, a plant lipid. The tertiary fold of this enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxylic acid.
404371	Lipase_GDSL_2	1.68e-15	460	644	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	2.39e-12	457	652	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
395531	Lipase_GDSL	4.81e-10	457	649	1	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT67685.1|CE0	0.0	1	1408	29	1436
QGI80975.1|CE0	0.0	1	1408	29	1437
UMZ45332.1|CE0	0.0	13	1408	41	1455
QPC64279.1|CE0	0.0	423	1408	16	844
UQC90643.1|CE0	0.0	438	1389	342	1309

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HYQ_A	4.66e-14	28	264	7	181	Crystal structure of phospholipase A1 from Streptomyces albidoflavus NA297 [Streptomyces albidoflavus]
5MAL_A	1.33e-08	28	125	6	96	Crystal structure of extracelular lipase from Streptomyces rimosus at 1.7A resolution [Streptomyces rimosus],5MAL_B Crystal structure of extracelular lipase from Streptomyces rimosus at 1.7A resolution [Streptomyces rimosus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9S2A5|LIP1_STRCO	8.71e-11	24	125	36	130	Lipase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=SCO1725 PE=1 SV=1
sp|Q93MW7|LIP_STRRM	1.03e-07	28	125	40	130	Lipase OS=Streptomyces rimosus OX=1927 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FOYG_00920-t42_1-p1.