CAZyme Information: FOYG_00863-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_00863-t42_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
567		61629.94	6.4048

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717839.1:2119351-2121101(-)

Full Sequence      

MKVTSFITAAAAFSTAQAYATTSSCKCFPGDACWPSDSQWKSLNTTVNGRLIKTVPLGSP
CHDPTYDAVQCKYLQDQWQHPGIHMNSSSSVMAPWFANQSCDPFQPESRACELGNYVRYA
VEAQTKADVVNTINFARNNNIRFVIRNTGHDYNGRSTGAGALSVWTHRLKDIQFKDYNAN
GYKGKAVTLGAGVQGFDILKAGNDAGYVVIGGECPTVGVTGGYTQGGGHSALSTSFGLSA
QNTLEFEVVTADSGVVTASPTKNSDLFWALNGGGGGNWGVVLSMTVKAFPDAKVGAATLA
FFNTNNDQATFYKAIETFHSKLPGMVDAGSMVVYYFTNTFFQIAPLTAFGKSQDEVQTLL
APFVSSLDTLGVNYTVKYSQSANYYNHYDTYFGPLPIGNIQVGIAQYGGRLIPRDTIVNN
NDDLTQAAISIVEQGVTWIGVGTNVAPFSNPQKQSLLPAWNNALVHATLTTPWNFTAPWS
DMLDLQNLMTDTIMPEIEAVTPGSGAYMNEADFRQPNFQSEFFGANYNKLLSVKAKWDKQ
GFFYARNAVGSEQWTVSDNGRMCRPRY

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	121	328	2.8e-49	0.4344978165938865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	4.65e-19	121	259	5	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	8.02e-15	121	314	36	229	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	3.20e-10	506	550	1	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	1.83e-05	100	269	44	220	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	1.31e-58	24	564	499	1065
QKD57322.1|CBM91|GH43_11	1.31e-58	24	564	499	1065
QRC92907.1|AA7	5.63e-15	103	551	60	492
UPK90596.1|AA7	7.62e-12	121	313	24	213
CAE7214923.1|AA7	1.16e-11	149	551	95	491

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	1.71e-136	24	564	27	573	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	3.84e-62	22	564	27	597	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6EO5_A	1.90e-20	118	543	45	462	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
6EO4_A	1.90e-20	118	543	45	462	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
6FYE_A	3.95e-15	128	300	56	217	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A0E0RTV6|ZEB1_GIBZE	7.19e-232	22	564	24	562	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2
sp|A0A075TR33|PATO_PENEN	7.45e-170	22	564	25	566	FAD-linked oxidoreductase patO OS=Penicillium expansum OX=27334 GN=patO PE=1 SV=1
sp|A1CFM2|PATO_ASPCL	4.99e-168	23	564	27	567	FAD-linked oxidoreductase patO OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patO PE=1 SV=1
sp|G0R6T3|SORD_HYPJQ	6.67e-147	22	564	36	572	FAD-linked oxidoreductase sor8 OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=sor8 PE=3 SV=1
sp|A0A0C6E5D0|BET5_NEOBT	8.01e-137	10	564	17	585	FAD-linked oxidoreductase orf1 OS=Neocamarosporium betae OX=1979465 GN=orf1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000284	0.999700	CS pos: 20-21. Pr: 0.9135

TMHMM  Annotations     

There is no transmembrane helices in FOYG_00863-t42_1-p1.