CAZyme Information: FOYG_00825-t42_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_00825-t42_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
442		47963.04	6.4998

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717839.1:2031602-2032930(-)

Full Sequence      

MHFEMANLKSLIFLAAVSAVRATISPGSLVTISTAVDATSGAAWWDPLDEYGGYDWLAYL
RNPPGGAIADNNVMVARRSISDGSVSRDCVRDSDGECAVFADDLGHNTPSISVDGDGYVH
VFTSMHNEPWKYFRSSQPYSSTLVNASSDMPDQTVLITYPVIKRDVDGNLWLIVRGQASG
DGSARGGYFYKYTTDNKKWTRVSLWAYNKGYSVYPDDIAFSSDGDVHVQWEWSKYPASAV
RHQGSYVRYRPSTNSFTSASGSTVSTPITQNTADIVYQPLTSGETYSGDINASPGPAFQS
AKMALYERPAGTVHIQSAYRFKTSTSGTWQVRRATATYGTSNPWTREILYSDSETSAGIG
ITHDGTTARIYYSRSSASAFVLENVGGAGWTNTAIEPAIGKKVQRLQALMRSDGTDVLYL
GAPTNVNSTTGSLYLLTVGGRT

Enzyme Prediction     

No EC number prediction in FOYG_00825-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL42	69	278	5.5e-30	0.6925675675675675

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406346	BNR_4	1.42e-28	69	335	9	272	BNR repeat-containing family member. BNR_4 is a family which carries the unique sequence motif SxDxGxTW which is so characteristic of the repeats of the BNR family, pfam02012. It is unclear whether or not this unit is repeated throughout the sequences of this family, but if it is then the family is likely to be bacterial neuraminidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD49281.1|PL42	0.0	5	442	1	438
QGI99108.1|PL42	1.31e-317	5	442	1	438
QGI68218.1|PL42	5.22e-317	5	442	1	438
QPC78152.1|PL42	1.24e-279	5	441	1	437
CZS83278.1|PL42	4.13e-278	5	441	1	437

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MUM_A	5.74e-10	106	274	95	261	Glycoside Hydrolase BACINT_00347 [Bacteroides intestinalis DSM 17393]
5MUK_A	1.01e-09	106	335	90	313	Glycoside Hydrolase BT3686 [Bacteroides thetaiotaomicron VPI-5482],5MUL_A Glycoside Hydrolase BT3686 bound to Glucuronic Acid [Bacteroides thetaiotaomicron VPI-5482]
5MVH_A	2.37e-09	106	274	90	256	Glycoside Hydrolase BACCELL_00856 [Bacteroides cellulosilyticus DSM 14838]
4IRT_A	5.31e-09	106	274	73	239	Crystal structure of a putative neuraminidase (BACOVA_03493) from Bacteroides ovatus ATCC 8483 at 1.74 A resolution [Bacteroides ovatus ATCC 8483]
7ESK_A	4.11e-08	46	249	31	237	Chain A, L-Rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum],7ESM_A Chain A, L-rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]

Swiss-Prot Hits     

FOYG_00825-t42_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000241	0.999749	CS pos: 22-23. Pr: 0.9655

TMHMM  Annotations     

There is no transmembrane helices in FOYG_00825-t42_1-p1.