CAZyme Information: FOYG_00358-t42_2-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOYG_00358-t42_2-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409		44794.73	7.8684

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumNRRL32931	17642	660029	362	17280

• Gene Location: location=JH717839.1:854346-855738(+)

Full Sequence      

MFFNTQSLGVVALAGLATAVPSRNHLQTREVGKLPALGWNGWNQGQCNAASEKVALATAK
TFINLGLKDAGYQYVNIDDCWSTKQRDSKGNLVPDPAKWPRGIKPVADEIHAMGLKFGLY
GDGGAKTCAGYPGSQGHEQQDANLLASWGVDYWKYDNCYTPCNTGNGADIQTCPNNQAPS
SRPRYEKMRDLLRATGRDILYSLCNWGYDEVWTWGAQVGHMWRMSQDNWGKWADVVRIAN
QAAPILKYTVPGHYNDLDMMILANGALTPAEERTHFAIWCITKSPIILGTDMTKLNSDEV
KLITNKGLLAVNQDSLSKPAVPFTPPNTPAKGTSEIYPYWSGPISTGTVVAIVASKGNLN
TQLNLKDVPGLKDMEYSWTELLTGAKGKGKTVSANLQTHDVAVFRIDHN

Enzyme Prediction     

No EC number prediction in FOYG_00358-t42_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	130	366	1e-68	0.9213973799126638

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269893	GH27	2.74e-136	35	314	1	271	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
166449	PLN02808	1.14e-90	12	358	9	331	alpha-galactosidase
177874	PLN02229	5.39e-90	35	345	63	351	alpha-galactosidase
178295	PLN02692	1.40e-87	23	357	44	354	alpha-galactosidase
374582	Melibiase_2	3.00e-76	35	314	2	284	Alpha galactosidase A.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAJ23877.1|GH27	0.0	1	409	1	409
CCT72200.1|GH27	7.98e-315	1	409	1	409
QGI98724.1|GH27	9.31e-314	1	409	1	409
QGI85072.1|GH27	9.31e-314	1	409	1	409
QGI67837.1|GH27	9.31e-314	1	409	1	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SZN_A	4.33e-87	32	406	9	410	Chain A, alpha-galactosidase [Trichoderma reesei],1T0O_A Chain A, alpha-galactosidase [Trichoderma reesei]
1UAS_A	5.19e-80	31	316	5	274	Chain A, alpha-galactosidase [Oryza sativa]
3A5V_A	7.28e-80	35	358	9	332	Crystal structure of alpha-galactosidase I from Mortierella vinacea [Umbelopsis vinacea]
6F4C_B	1.06e-79	31	404	5	358	Nicotiana benthamiana alpha-galactosidase [Nicotiana benthamiana]
3LRK_A	4.62e-76	11	364	11	370	Chain A, Alpha-galactosidase 1 [Saccharomyces cerevisiae],3LRL_A Chain A, Alpha-galactosidase 1 [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94221|AGALB_PENSI	2.42e-96	7	404	4	429	Probable alpha-galactosidase B OS=Penicillium simplicissimum OX=69488 GN=agl1 PE=2 SV=1
sp|A2QEJ9|AGALB_ASPNC	3.08e-96	13	404	5	437	Probable alpha-galactosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=aglB PE=3 SV=1
sp|A1C5D3|AGALB_ASPCL	5.04e-96	8	406	6	444	Probable alpha-galactosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=aglB PE=3 SV=1
sp|Q9Y865|AGALB_ASPNG	1.23e-95	13	404	5	437	Probable alpha-galactosidase B OS=Aspergillus niger OX=5061 GN=aglB PE=2 SV=1
sp|A1D0A3|AGALB_NEOFI	2.18e-94	5	404	2	441	Probable alpha-galactosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=aglB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000260	0.999716	CS pos: 29-30. Pr: 0.7469

TMHMM  Annotations     

There is no transmembrane helices in FOYG_00358-t42_2-p1.