CAZyme Information: FOXG_21620-t26_4-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_21620-t26_4-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1063	CM000600.1|CGC12	118271.03	6.5370

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000600.1:1984718-1988137(+)

Full Sequence      

MIDMIDSGTSGRSVSISGAAANGPLGHVTGLSLGTSTPVPVVAIIGDKGSGKTSLFEALS
GLSLHGSRLSSTKFPIHAYFTNTSRAGTTLKARIKPGKVDGQNKELSEHLQSFEVNYEGD
LAAVNLPHIVRQATNHMQVATAFSDEKEQEEQQVSDNVLVIEIAGPDLFSMEIVDTPGLS
SSEWHCRACWLGWKLTSTGPTVDDAQELTRALILDLVKQPNTIILSVSHLSVSNVKLTKF
RAVVDATNDMSSQEGPWLARAADVTGNRTVAVVTKCDLVPLEERRFVLRAMRNKERHLGH
PWFATRSLSCNERDQDCTLETRNSIEGSLFSEKEWAVLKRRRRVGALALRDHLKTRVNVM
LRGSIDLLTTLLNTPAHSVAPTHTANTDKVQPTDVYATSQETVVADADLEFASDAPRPTP
LLNAVIVALTVAICLCLIALGCSTMAMEIASEGGWTRLFLLITAVPQIILSLFFCQAIVV
TIFQMIGPVTQLKVNSKFYSAKRTRRLDGTKVLLPHVTIQCPVYKEGLEGVIRPTVRSLS
AAIRNYESFGGTASIFINDDGMQLVSPEEADERRMFYKENNIGWVARPAHNANGEGISKF
IRRGKFKKASNMNYALGISLKVEDKLVQIVRDEHWTQADESAAYQRCLDEVLSEELGRAW
VGGDIRVGDYLLLVDSDTRVPTDCLIDAVSELEASPRVAILQFTSGVMNVTTSYFESGIT
FFTNLIYTAIAYAVANGDVSPFVGHNAFIRWSALQEVGSQDDGIICNEKDPNATTPYEKF
WSESHVSEDFDVSLRLQTLGYHIRLATYCGDGFKEGVSLTVYDELARWQKYAYGCSELLF
YPIKDWWRYGIFTPLFKRFIMSNMPLGSKITIMSYIGTYYAIGYSWIGSLLNYFLIGWLN
GELDHYYMSSWRVWVALVVVFSIAGNITLALIRYRSQQVSLLRELWTCFKWVALMFVFLG
GISMHVCKAILCHMLSIDIGWGATSKEVEDTNFFQEISIIIAGFKYVFIFCLAVTALMIC
GVYAFPYLWRINELVAIFPLATIIFCHFFLPIALNPNLMKFTW

Enzyme Prediction     

No EC number prediction in FOXG_21620-t26_4-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	670	895	6.1e-48	0.9695431472081218

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	3.70e-44	670	896	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
206738	DLP_1	5.09e-39	38	353	2	265	Dynamin_like protein family includes dynamins and Mx proteins. The dynamin family of large mechanochemical GTPases includes the classical dynamins and dynamin-like proteins (DLPs) that are found throughout the Eukarya. These proteins catalyze membrane fission during clathrin-mediated endocytosis. Dynamin consists of five domains; an N-terminal G domain that binds and hydrolyzes GTP, a middle domain (MD) involved in self-assembly and oligomerization, a pleckstrin homology (PH) domain responsible for interactions with the plasma membrane, GED, which is also involved in self-assembly, and a proline arginine rich domain (PRD) that interacts with SH3 domains on accessory proteins. To date, three vertebrate dynamin genes have been identified; dynamin 1, which is brain specific, mediates uptake of synaptic vesicles in presynaptic terminals; dynamin-2 is expressed ubiquitously and similarly participates in membrane fission; mutations in the MD, PH and GED domains of dynamin 2 have been linked to human diseases such as Charcot-Marie-Tooth peripheral neuropathy and rare forms of centronuclear myopathy. Dynamin 3 participates in megakaryocyte progenitor amplification, and is also involved in cytoplasmic enlargement and the formation of the demarcation membrane system. This family also includes interferon-induced Mx proteins that inhibit a wide range of viruses by blocking an early stage of the replication cycle. Dynamin oligomerizes into helical structures around the neck of budding vesicles in a GTP hydrolysis-dependent manner.
224136	BcsA	2.41e-15	458	989	1	427	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
395279	Dynamin_N	2.66e-13	42	275	1	167	Dynamin family.
133045	CESA_like	1.93e-09	522	789	4	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI99503.1|GT0	0.0	16	1063	1	1034
QGI68613.1|GT0	0.0	16	1063	1	1034
CCT73007.1|GT0	0.0	16	1063	1	1016
QKD62182.1|GT0	0.0	137	1063	1	912
QGI85813.1|GT0	0.0	402	1063	5	642

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4P4S_A	1.11e-07	39	298	13	214	GMPPCP-bound stalkless-MxA [Homo sapiens]
4P4S_B	1.43e-07	39	298	28	229	GMPPCP-bound stalkless-MxA [Homo sapiens]
4P4T_A	1.52e-07	39	298	34	235	GDP-bound stalkless-MxA [Homo sapiens]
4P4U_A	1.54e-07	39	298	34	235	Nucleotide-free stalkless-MxA [Homo sapiens]
5GTM_A	2.50e-07	39	298	38	239	Modified human MxA, nucleotide-free form [Homo sapiens],5GTM_B Modified human MxA, nucleotide-free form [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5U752|MX_SOLSE	6.07e-10	39	332	33	268	Interferon-induced GTP-binding protein Mx OS=Solea senegalensis OX=28829 GN=mx PE=2 SV=1
sp|Q800G5|MXE_DANRE	1.64e-08	39	294	43	240	Interferon-induced GTP-binding protein MxE OS=Danio rerio OX=7955 GN=mxe PE=2 SV=1
sp|Q6TKS7|MX_CTEID	2.84e-08	39	294	43	243	Interferon-induced GTP-binding protein Mx OS=Ctenopharyngodon idella OX=7959 GN=mx PE=2 SV=1
sp|Q6PW23|MX_EPICO	4.91e-08	39	332	33	268	Interferon-induced GTP-binding protein Mx OS=Epinephelus coioides OX=94232 GN=mx PE=2 SV=1
sp|Q6DKF0|MXC_DANRE	4.91e-08	39	294	43	240	Interferon-induced GTP-binding protein MxC OS=Danio rerio OX=7955 GN=mxc PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000070	0.000000

TMHMM  Annotations     

Start	End
424	446
458	480
713	735
876	898
913	932
945	967
1006	1028
1035	1054