CAZyme Information: FOXG_20086-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_20086-t26_1-p1
• CAZy Family: GT35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
903		98929.67	4.3239

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000599.1:623237-626584(-)

Full Sequence      

MMKGLVRLLAISSTLARVASAKAVLAHYMVGTVTQEHAHKDIDNAKSMGLDGFALNIGDA
TCEYVSQALSYLFPYAESVGFKLYISMDVYASGDACYHGAKSCHGPSDYQWIWDSYKGSS
AYYQVKGRPLISTFSSGGFHNDTWIDWKKGLANDMFFMPDFDETEGYYDPADEWWSYWGP
IVDGIFSWESAWPERKGFGGNPLQYKNAYGAHVYRQGDLNLPKRMINILNMDPQPDYVQF
QTWNDGPEAHYIGNLWTEQNNDTEPYFYANQETWDHTGWQPLVSSFVNAYKTGQSASQMT
PMNGDVLVGAAWYRTELSDVKCPYEGNDAYYNKPDGWDDDVKYLYYAIILNPSYGSGYKV
TVSGSTEHTAPLNPGMNYGYGAGEVQTGAQRITVKDPSGNVIYTATGGMCVSDGCPNYIY
NGNYQVLPLKKGNVDPICNQWPGMDHSACGYGTCHASGDGSNNAAGDDFTHVTCTNPGVT
DASKDAKFRWDSVYADQAWTWGVDQWNANPFPGGLNFTEQFSNLFHGPEGIDCGTIENDN
PCGSNVVQCNDVTCPGAYFAINSMESIYRVHFNFWDALDRAQNDINAQVGEVSSTFAPIK
SSDFSVKLLLDIIALKGMPYFKANPNTLATVKDWVNPMVTNSITIAKDTLKDDSALSAEN
SISTRLNAIVTIWQAEIVSMNEQLFNGSKENTDLLFTAITDGQMLETKHQDLGIDAIQAL
VSKALFAELVPLAWQLSSSELGPVVIDSEQGCGDKHDVKHMSSKSYDSSGVCVDSKMYYL
IGCTGEARTCDESHGSFNPGCTDNFFSNLPGLDDLTGSETAFGGLTKEDIVNGAVNSFAG
NGNANGWSMLDPSNTVDGMGLVSEYNVTAPGVVMLPVCTASEAFSNWFSFTNGKPKSANY
PCN

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH71	24	195	7e-31	0.416
GH71	212	396	8.5e-17	0.4533333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397634	Glyco_hydro_71	2.94e-88	24	402	1	371	Glycosyl hydrolase family 71. Family of alpha-1,3-glucanases.
211418	GH71	5.70e-64	18	293	1	283	Glycoside hydrolase family 71. This family of glycoside hydrolases 71 (following the CAZY nomenclature) function as alpha-1,3-glucanases (mutanases, EC 3.2.1.59). They appear to have an endo-hydrolytic mode of enzymatic activity and bacterial members are investigated as candidates for the development of dental caries treatments.The member from fission yeast, endo-alpha-1,3-glucanase Agn1p, plays a vital role in daughter cell separation, while Agn2p has been associated with endolysis of the ascus wall.
211414	GH99_GH71_like	1.48e-14	24	270	1	269	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.
211416	GH99_GH71_like_3	2.23e-05	72	252	105	307	Uncharacterized glycoside hydrolase family 99-like domain. This family of putative glycoside hydrolases resembles glycosyl hydrolase families 71 and 99 (following the CAZY nomenclature) and may share a similar catalytic site and mechanism.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60832.1|GH71	0.0	2	903	1	943
QGI69917.1|GH71	0.0	2	902	1	942
QGJ00805.1|GH71	0.0	2	902	1	942
CCT74490.1|GH71	0.0	2	902	1	909
QGI87293.1|GH71	0.0	2	902	1	875

PDB Hits     

FOXG_20086-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13716|AGN1_SCHPO	4.92e-16	22	377	22	375	Glucan endo-1,3-alpha-glucosidase agn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn1 PE=1 SV=2
sp|O94510|AGN2_SCHPO	3.76e-08	22	376	11	375	Ascus wall endo-1,3-alpha-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000865	0.999095	CS pos: 21-22. Pr: 0.9146

TMHMM  Annotations     

There is no transmembrane helices in FOXG_20086-t26_1-p1.