CAZyme Information: FOXG_19864-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_19864-t26_1-p1
• CAZy Family: PL4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371		40228.86	8.8283

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000590.1:4277271-4278424(+)

Full Sequence      

MASRQPDPIQPGMVSNCNKFYFVEQGDNCNAVSSKHGITLAQFTTWNPSSARVAQDCGLM
SGSSTKPTNGIETPSPIQAGMTKSCNKFHLIKSTTTCNSIQDYYKLPLKDSYSWNPAVGT
NCQSLLVDYWVCVSVVGWTAPSPTTPSNGITTPTPIQTGMAKNCNKFHTIKSTTTCASIQ
DYYKISFADFYAWNPAIGSKCTSLLVGYNVCVGVIGQTPSPTSTGNGITTPTPIQAGMTK
RCNKFHPVKSTTTCASIQDYYKISFADFYVWNPAIGSKCTALWVDYNVCVGVVGQKPTPT
QPSNGVTTPSPIQSGITKNCKKFHQVKSTTTCASIQNYYKITMANLFKWNSAIGPTCKSL
WVDYCLYPIAG

Enzyme Prediction     

No EC number prediction in FOXG_19864-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
180536	PRK06347	1.55e-05	19	272	331	576	1,4-beta-N-acetylmuramoylhydrolase.
212030	LysM	8.72e-05	166	210	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	9.44e-05	19	50	1	32	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
180536	PRK06347	2.06e-04	156	351	247	435	1,4-beta-N-acetylmuramoylhydrolase.
212030	LysM	7.38e-04	322	366	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CZS82988.1|CBM50	4.57e-173	6	364	131	517
QKD52295.1|CBM50	5.80e-166	6	364	139	403
UPK92405.1|CBM50	8.26e-150	6	364	134	501
QGI87027.1|CBM50	2.20e-141	5	364	264	655
QGI69682.1|CBM50	4.57e-141	5	364	289	680

PDB Hits     

FOXG_19864-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	4.53e-82	6	293	144	458	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4B4P8|LYSM2_ARTBC	6.38e-18	169	301	34	190	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AZ68|LYSM3_ARTBC	2.31e-13	231	364	256	402	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1
sp|D4B5F9|PGDA_ARTBC	6.34e-11	157	214	380	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000030	0.000032

TMHMM  Annotations     

There is no transmembrane helices in FOXG_19864-t26_1-p1.