CAZyme Information: FOXG_19667-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_19667-t26_1-p1
• CAZy Family: GT34
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
78		9273.32	4.6112

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000594.1:1049793-1050029(+)

Full Sequence      

MDYWKTVSETKATHTHGLRNDYHDQDEFVFKIDLSEATDLEYKPMFLCIRYEVGGREFWD
NNSGAIFQVDFLKMGNKE

Enzyme Prediction     

No EC number prediction in FOXG_19667-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	1	69	4e-16	0.6261682242990654

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	3.37e-19	1	70	42	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	0.006	2	65	19	71	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK95418.1|CBM21	2.31e-21	1	73	160	228
UPL00131.1|CBM21	2.10e-19	1	73	303	375
ANH22731.1|CBM21	2.48e-19	1	73	355	429
QKD63139.1|CBM21	3.78e-19	1	77	288	369
QPH02784.1|CBM21	4.65e-19	1	73	369	443

PDB Hits     

FOXG_19667-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

FOXG_19667-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000074	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FOXG_19667-t26_1-p1.