CAZyme Information: FOXG_19425-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_19425-t26_1-p1
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		43375.81	8.2194

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000591.1:4255724-4256866(+)

Full Sequence      

MFIETLIAQGPSTEPYVTVPRRQITQNALTILTQNWTWRESLMPKQDIAASQETTPKTLQ
DDEIVAKRLSKRLSSSSQNASNGSKEQDSCQSHVGSNLSTIAFNNQKLAGEVQRWRDSVR
SRCSEPLESCIPPDKPDDKSPQSSERLLLKDKVKKDQTDLDTHGKSLVSGLRQPRRPRSR
NPACTKTVHFAPDLEQICHFYGTDRPSAVNSVSALVDDWRRDKVSSSSHHEWPCRRASSY
YWVINTPNFPQDAVARQSMPVRLDEIKVLAHETAIVGSVVVANLDFHKSVACRYTLDYWK
TVSETEAIYNADQCGRNQDYDMFIFKIDLTEYIDLGYKPMFLCIRYVVGGQEFWDNNSYA
NFQLDFIKIGRRKQTAQLKV

Enzyme Prediction     

No EC number prediction in FOXG_19425-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	259	363	1.2e-29	0.9626168224299065

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	6.05e-40	256	365	2	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	1.00e-04	283	362	1	73	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK95418.1|CBM21	3.11e-52	182	368	52	228
UPL00131.1|CBM21	1.44e-47	173	368	183	375
QKX59775.1|CBM21	8.30e-47	164	368	201	402
QUC19120.1|CBM21	1.08e-46	98	368	162	428
ANH22731.1|CBM21	2.01e-46	98	368	162	429

PDB Hits     

FOXG_19425-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40187|PIG2_YEAST	8.26e-13	260	367	391	510	GSY2-interacting protein PIG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIG2 PE=1 SV=1
sp|Q9VVY3|GBS76_DROME	2.95e-10	275	362	546	629	Glycogen-binding subunit 76A OS=Drosophila melanogaster OX=7227 GN=Gbs-76A PE=1 SV=1
sp|Q6DDQ5|PPR3C_XENLA	2.88e-09	272	364	147	237	Protein phosphatase 1 regulatory subunit 3C OS=Xenopus laevis OX=8355 GN=ppp1r3c PE=2 SV=1
sp|Q803M0|PPR3B_DANRE	6.92e-08	272	364	146	236	Protein phosphatase 1 regulatory subunit 3B OS=Danio rerio OX=7955 GN=ppp1r3b PE=2 SV=1
sp|Q28E28|PPR3B_XENTR	9.73e-08	272	364	159	249	Protein phosphatase 1 regulatory subunit 3B OS=Xenopus tropicalis OX=8364 GN=ppp1r3b PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FOXG_19425-t26_1-p1.