CAZyme Information: FOXG_19298-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_19298-t26_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		42887.04	7.5874

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000591.1:2653997-2655127(-)

Full Sequence      

MSIAAFTPQNASRESYVTAARRQVTKNASYNLTQHWTWPESLMSRQDIPTLQETTPKTLQ
DNKTVAEGLFKRLPSSSLNASNGSEEQDSCQPHINSNLSTIPFNNPTLVGEVHQWRDLVR
SWCSQPLESCVTPGKPDDKSPQNSERLLLKDEVGNYQAGRNTHSKSLGFALPQPSRLSSR
KSACTKTVHFAPDLEQICHFYRTDRPSAVNSISALVDDWRRDKVSSSSHHEWPCRRASSY
YWAINTPNFPQDAVARQSMPVRLDKIIFSAPETAIMGSVIVANLDFHKLVACRYTLDYWK
TVSETEAIYNADQCGRNQDYDVFIFKIDLTECIDLEYKPMFLCIRYVVSGQEFWDNNSYA
NFQVDFMKKGRRQQTA

Enzyme Prediction     

No EC number prediction in FOXG_19298-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	259	364	7.8e-30	0.9719626168224299

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	6.42e-41	256	365	2	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	8.79e-06	283	364	1	75	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK95418.1|CBM21	1.04e-55	150	369	17	229
QKD63139.1|CBM21	4.97e-54	29	369	13	362
UPL00131.1|CBM21	1.23e-53	134	369	145	376
QUC19120.1|CBM21	1.66e-49	39	369	103	429
ANH22731.1|CBM21	1.94e-48	39	369	104	430

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2M83_A	2.03e-10	257	369	28	138	Solution structure of the carbohydrate binding module of the muscle glycogen-targeting subunit of Protein Phosphatase-1 [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40187|PIG2_YEAST	2.49e-10	275	372	408	515	GSY2-interacting protein PIG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIG2 PE=1 SV=1
sp|P40036|GIP2_YEAST	3.36e-10	275	370	439	539	GLC7-interacting protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GIP2 PE=1 SV=1
sp|Q9VVY3|GBS76_DROME	5.06e-10	252	362	524	629	Glycogen-binding subunit 76A OS=Drosophila melanogaster OX=7227 GN=Gbs-76A PE=1 SV=1
sp|Q6DDQ5|PPR3C_XENLA	2.10e-09	269	364	144	237	Protein phosphatase 1 regulatory subunit 3C OS=Xenopus laevis OX=8355 GN=ppp1r3c PE=2 SV=1
sp|Q00756|PPR3A_RABIT	3.28e-09	135	369	2	236	Protein phosphatase 1 regulatory subunit 3A OS=Oryctolagus cuniculus OX=9986 GN=PPP1R3A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000016	0.000021

TMHMM  Annotations     

There is no transmembrane helices in FOXG_19298-t26_1-p1.