CAZyme Information: FOXG_18811-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_18811-t26_1-p1
• CAZy Family: GT2|GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518	CM000592.1|CGC2	56035.52	4.6183

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000592.1:4255504-4257282(+)

Full Sequence      

MKFSAAIVAAAATAASAKLEPITMKGSKLFYSNGTQFFMKGVAYQQDTAAAGETNDKTTK
YIDPLADEEACKRDIPLLKQLGTNIIRTYAINPKADHKACMKLLDDAGIYVISDLSEPSV
SINRDDPKWDVELYERYIGVVDELGQYDNVVGFFAGNEVSNNVSNTQASAFVKAAVRDTK
KHIKSKFSRWLGVGYASNDDVDIREQIADYFNCGDDDSRIDYWGYNIYSWCGKSSMQDSG
YSDQAKFFEDYSVPVFFAEYGCNEPDGAAGRIFDETTALYEEKVMTDVFSGGIVYMYFQE
ANDYGLVKISKNGDAVKQKDFAQLQKKANAAKPSGVEEDSYKPTGKAATCPEQSKNWKAN
SVLPPVPDSDLCDCMVKSRSYKKICTAINANATAGIYGAYSMCSNEAKLAYILDAYYTSQ
KSAADACDFKGKATTQKAESQDSCKSALASASKINEEVATATHAVASSSTGGSNSSSEDD
ENFGLQAASIARVFSLGDFAVGAYMAVAGVVGAGMVLL

Enzyme Prediction     

EC	2.4.1.-:3	2.4.1.-:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	17	329	4.7e-128	0.9839743589743589

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	8.13e-146	18	327	8	310	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	1.08e-16	385	434	27	76	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	2.72e-10	385	446	28	85	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.
225789	LacZ	6.60e-04	28	174	291	422	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD48906.1|CBM43|GH72	0.0	1	518	1	540
AAX78216.1|CBM43|GH72	0.0	1	518	1	539
QGI67878.1|CBM43|GH72	0.0	1	518	1	540
QGI98764.1|CBM43|GH72	0.0	1	518	1	540
CCT72239.1|CBM43|GH72	0.0	1	518	1	540

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	1.08e-105	18	417	32	456	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	3.03e-105	18	417	32	456	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	3.03e-105	18	417	32	456	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ATC3|GAS1_ARTBC	5.91e-168	1	518	1	545	1,3-beta-glucanosyltransferase ARB_07487 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07487 PE=1 SV=1
sp|P0C956|GEL4_ASPFU	1.77e-146	26	451	43	486	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel4 PE=3 SV=1
sp|B0XVI5|GEL4_ASPFC	1.77e-146	26	451	43	486	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel4 PE=1 SV=1
sp|P56092|EPD1_CANMA	2.67e-143	13	451	19	468	Protein EPD1 OS=Candida maltosa OX=5479 GN=EPD1 PE=3 SV=1
sp|P22146|GAS1_YEAST	1.50e-139	4	448	12	466	1,3-beta-glucanosyltransferase GAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001080	0.998913	CS pos: 17-18. Pr: 0.9158

TMHMM  Annotations     

There is no transmembrane helices in FOXG_18811-t26_1-p1.