CAZyme Information: FOXG_18506-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_18506-t26_1-p1
• CAZy Family: GT2|GT2
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
770	CM000596.1|CGC14	84328.82	5.3021

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000596.1:1681308-1683863(-)

Full Sequence      

MKLSGYLCVAVLAVAGQAAKDKPVYKDPKASIDDRVEDLLKRMTIQDKAAQLIQGDMTNY
LNLTDETVNKTGLAWNFKYRANSIWTGLYANMTTIKKAAKLGQDYLAKETELGIPAFVQS
EGLHGVLILNGTIFNSPIGMGCSFNPELIEKMADVIATESRAVGINQLFSPQVDLARELR
FGRVEECFSEDPYLAGEMGYRYVKGLQAGGVSAMVKHYAAFATPEQGINTGPVHGGEREL
RSLYLPPFKRAIIDGGATSIMSSYNSYDGVPVVSDSYLLTDILREEWGYKYYVISDAGGT
ARLAQAFYVCPLEDDECITLETLPAGNDAEMGGGYWSFEIIPELVKAGKLDEKVVDTAVS
RVLRSKFEMGLFEKPFTGVADDKIWDYVNTKAHKKVARQLDAESIVLLENHENILPLKKD
ANVAVIGPMAHGYVNYGDYVIHTAMTRGVTPYDGIKAASKGKVTFTQGCERWSTDESGFK
EAVAAAEAADVAVVVVGTWTRDQNELWGGLNATTGEHIDASNLNLIGAMPKLVKAIIETG
KPTVVVYSSGKPITEPWISEEASALIQQFYQSQEGGHALADILYGDVNPSGKLSVSFPYD
VGTTPIYYDHLNSARAWPNPGKIYENGTLKFGSNYVLENPEALYTFGYGLSYSKFDFSKI
SVSKKNVTATDTVTVSVDVSNKSKRDGSEVVQLYVKDMLASVDVARYQLKGFKKVAVKAG
KTQTVKIDLKVEDWGLWNRKMKYVVEPGDFTVFIGNSSENFKGNVTVTVS

Enzyme Prediction     

EC	3.2.1.120:1	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	107	331	1.1e-64	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.49e-159	1	762	1	758	beta-glucosidase BglX.
224389	BglX	2.21e-84	43	431	1	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	1.50e-61	77	756	49	770	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	3.45e-60	44	364	1	315	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	9.56e-46	405	652	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD56125.1|GH3	0.0	1	770	1	772
QGI96909.1|GH3	0.0	1	770	1	778
QGI83266.1|GH3	0.0	1	770	1	778
QGI66027.1|GH3	0.0	1	770	1	778
CCT70172.1|GH3	0.0	1	770	1	772

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	0.0	21	769	3	756	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	0.0	21	769	3	756	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	2.79e-120	11	762	25	778	Chain A, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5TF0_A	8.90e-120	33	762	10	744	Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5XXL_A	1.10e-114	26	762	5	745	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KMH0|PLH24_FORAG	3.47e-122	88	759	40	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|Q56078|BGLX_SALTY	1.05e-121	33	762	35	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	1.05e-121	33	762	35	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH9|PLH34_FORAG	9.44e-102	25	762	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
sp|P14002|BGLB_ACET2	8.36e-95	112	770	35	669	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000343	0.999634	CS pos: 18-19. Pr: 0.9764

TMHMM  Annotations     

There is no transmembrane helices in FOXG_18506-t26_1-p1.