CAZyme Information: FOXG_17711-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_17711-t26_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391		43259.69	6.6341

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=DS231777.1:4150-5325(+)

Full Sequence      

MKTSLAFASFIPFSCSLANAAPPSNYLNWKTFKANGVNVGGWLHQEAVIDPTWWNQYAPG
TPDEWDFCAKLKSKCGPILEQRYGSYITTKDIDTMAAAGINVIRVPTGYNAWVTVPGSQL
YSGNQARFLRTISDYAIKKHGIHVILDIHSLPGGLNGMGLGEKEGNYGWFQNQTALDYSY
QAVDAAIKFIQGSDVPQGFTLAPINEPVDNRDFTKFGTPEALTEEGAAWVLEYFQGVISR
VEKANPKIPIMLQGGFRPVDFWAKYFAVSTNLVFDVHNYYFAGRPTTSQNLPEFICTDAK
NTISSTSPKFPVFVGEWSIQAATNNTFASRARNLNTGLKAWATYTQGSAYWTWKFFGNEP
VDGEGTQGDYWNYSDFVKMGIIGPSSGVTCK

Enzyme Prediction     

EC	3.2.1.149:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	83	364	7.9e-141	0.9964285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.78e-15	22	387	6	392	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	4.44e-12	83	357	20	272	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62241.1|GH5_23	2.06e-301	1	391	1	391
CCT65263.1|GH5_23	3.98e-274	1	391	1	391
QGI78607.1|GH5_23	3.33e-267	1	389	1	389
QGI61425.1|GH5_23	3.33e-267	1	389	1	389
QGI92323.1|GH5_23	3.33e-267	1	389	1	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LA0_A	4.95e-150	26	382	11	364	Chain A, Glycoside hydrolase family 5 [Aspergillus oryzae],6LA0_B Chain B, Glycoside hydrolase family 5 [Aspergillus oryzae]
6I1A_A	1.69e-147	20	382	7	369	Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger],6I1A_B Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger]
1EQP_A	1.09e-15	36	318	11	288	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PF0_A	2.72e-15	36	318	17	294	Chain A, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	3.54e-15	36	318	11	288	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAR6|EXGA_ASPNC	2.19e-32	24	318	32	310	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|A1CRV0|EXGA_ASPCL	2.94e-27	27	318	35	309	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
sp|B0XN12|EXGA_ASPFC	2.43e-25	17	318	19	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q4WK60|EXGA_ASPFU	3.32e-25	17	318	19	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|A1D4Q5|EXGA_NEOFI	8.49e-25	17	318	19	310	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000291	0.999694	CS pos: 20-21. Pr: 0.9713

TMHMM  Annotations     

There is no transmembrane helices in FOXG_17711-t26_1-p1.