CAZyme Information: FOXG_17429-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_17429-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
869	DS231744.1|CGC2	94738.88	8.0342

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=DS231744.1:95170-98053(+)

Full Sequence      

MADNKRKTIRYELAGDDSPSLTPATPTPAYQSLRNTRSTGDLSHAAELPGDFSSESSSPY
TFANLFENDVKIQDDARVEIDCNSKFVRTLSRLYQTSPEKYAQPDTPTPEYTEFESRSKT
WATKLNIVIQVVGSRGDVQPFIALGNELQRHGHRVRLATHNTFESFVRESGLEFYPVGGD
PAELMAYMVKNPGLIPSMKSLAAGEIQKKRDMVQWMLEEFWHSCLQPDPLTGLPFVADAI
IANPPSFAHIHCAQALGIPVHLMFTMPWSNTRAFPHPLANLKNVGSDPQLGNYISYTVVE
WMTWQGLGDIINKWRKSIDLEEVAMFDAPMLTKTLKIPFTYCWSPALVPKPVDWEPYIDV
CGFFFRDPPQFYPPTDLAQFLQNGPPPVYIGFGSIVLDNPEKVIGVILDSIEATGARAII
SKGWSALVGSEQENVYWIGDCPHEWLFQHVAAVIHHGGAGTTACGLRNGKPTTIVPFFGD
QPFWGQMVANAGAGPAPIPHRELTVDNLAAAIRYCLSPQAAAAAAIIAEKMSSEVGVRAA
VQSFHKGLPLERIRCDVIPSEPAVWSYSKSKNPIKLSKMAAEILISTNSIDSKHLKPYQS
NPIQTETTRWDPVSGGASAVMATATGMAGNITGIFTKPIEEYRDDQKRRAGELKYTQGRG
SPSLQERSSDKDHLSVERLSNDSVRPRSAHSGHLAGRMAGASAKSAGKIGQTATKGMLVD
FPLAITEGLKSVPQLYGGNVRNHGPVTDAKSGMVVAGKTFAWGFIDGLSDVVVQPYKGAK
KEGALGAAKGLGKGAMNLVTKSGAGMFGLFAYPSAGISKSLRTATHGSTRRKIAEERRAE
GIWMVKSGTGVQVDCSKVLEDFERLKRDT

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	150	544	4.3e-55	0.9633507853403142

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	3.02e-79	125	546	1	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	7.38e-45	127	546	4	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	4.14e-25	127	275	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	5.77e-06	136	519	7	360	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
278624	UDPGT	1.11e-04	388	513	278	403	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61343.1|GT1	0.0	58	840	9	789
CEI68149.1|GT1	0.0	1	863	1	855
UPK92276.1|GT1	0.0	1	867	1	858
CEF86870.1|GT1	0.0	1	867	1	861
CZS83364.1|GT1	0.0	1	867	1	861

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	1.73e-76	132	552	27	443	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	2.93e-76	132	552	47	463	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	3.35e-34	125	528	1	379	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	6.67e-31	125	528	1	362	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	6.78e-25	125	540	1	392	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	1.41e-136	70	551	108	577	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	3.11e-126	125	569	193	632	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|A1CYS1|ATG26_NEOFI	4.72e-76	122	548	908	1328	Sterol 3-beta-glucosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=atg26 PE=3 SV=1
sp|Q6C8M8|ATG26_YARLI	6.94e-76	123	552	993	1417	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|Q4WID6|ATG26_ASPFU	8.31e-76	122	548	899	1319	Sterol 3-beta-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=atg26 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FOXG_17429-t26_1-p1.