CAZyme Information: FOXG_17401-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_17401-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486	DS231744.1|CGC2	53562.71	4.7775

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=DS231744.1:2539-4227(-)

Full Sequence      

MTTSAKDQSLQHPHLRRDDNGSHLIVNGRPFLMLAGELHNSSLSSARYMAEVWPAMKEQA
INTLLGAISWEQIEPVEGEFDFAELDKVIVDAREQGMHLILLWFGTYKNALSTYVPSWVK
TDSKRFPRVRSIEAGGNRKILDIITPLSVECAEADAKAFGTLMSHIRELDEAYSTVLMVQ
VQNESGMLGDSRDRSPIAEAAFKEPVPEELLHLDSAISRSFITSAVVAGGSGPGVYPSGG
PCAHVSDIWEFNAPSLDFLAPDLYMQDYETICRDYTAKGNPLFIPEQRRDGEGGRRMWLA
YGTYGALGVSPFGIDTGAEAIGREYKVLTKVKDFILSALPANRFGFFFDEVEIAARVDKP
WVRVFGDIEVSVERAFTFGKPGPAGGLIIRLADRKFIVVGYGFQARFKGLAKGVTFTGLQ
NVKEMESDQEGKLHVLRTFNGDETRGGEAVVMPNEEPDYGDFPIATTIPARTGIAQVEVY
TLTEDA

Enzyme Prediction     

No EC number prediction in FOXG_17401-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	24	205	3.8e-30	0.5439739413680782

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407954	DUF5597	4.76e-23	321	450	1	129	Domain of unknown function (DUF5597). This is the C-terminal domain of xyloglucan utilization locus (XyGUL) present in Cellvibrio japonicas. XyGUL is required for xyloglucan utilization. It is also the C-terminal domain of PF02449 and PF01301.
396834	Glyco_hydro_42	2.50e-08	56	202	19	154	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
224786	GanA	8.00e-07	24	296	8	401	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
214750	Glyco_10	0.002	70	124	3	52	Glycosyl hydrolase family 10.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62285.1|GH35	2.53e-314	1	486	1	562
UPK90813.1|GH35	2.38e-246	1	486	1	560
CEI68128.1|GH35	9.01e-235	1	482	1	558
UPL04311.1|GH35	8.66e-214	13	485	16	560
CEI70370.1|GH35	6.02e-208	8	485	5	555

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3U7V_A	4.24e-64	1	447	28	535	The structure of a putative Beta-galactosidase from Caulobacter crescentus CB15. [Caulobacter vibrioides NA1000]
4D1I_A	5.32e-59	19	447	10	520	The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_B The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_C The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_D The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_E The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_F The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_G The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_H The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1J_A The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_B The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_C The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_D The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_E The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_F The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_G The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_H The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107]
5JAW_A	6.49e-59	19	447	20	530	Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_B Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_C Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_D Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_E Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_F Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_G Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_H Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],6TBF_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBI_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBJ_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107]
7KMN_A	2.56e-56	20	447	33	516	Chain A, Beta-galactosidase, GH35 family [Xanthomonas citri pv. citri str. 306],7KMO_A Chain A, Beta-galactosidase, GH35 [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

FOXG_17401-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000005

TMHMM  Annotations     

There is no transmembrane helices in FOXG_17401-t26_1-p1.