CAZyme Information: FOXG_17167-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_17167-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
632		69119.43	4.4064

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=DS231741.1:112636-114717(+)

Full Sequence      

MGKEFKAKGVNVLLGPNVGPLGRTPLGGRNWEGFSVDPYLTGQLSAESIIGHQDAGVIAN
VKHFIANEQETFRRPYFGIEAVSSNIDDKTLHEYYLWPFVDSVRAGVASVMCSYNRVNGT
YACENSKLMNGLLKTELEFEGFVLLDWNAQHNLESANAGLDMVMPMGGFWGENLTMAVEN
GTVKEARVTDMATRILAAWYLVGQDIDFPTPGIGMKNLSLPHEQVEARIPESRPTLLEGA
IAGHVLVKNENNTLPFAQKPKMISVFGYDATVAKTKNTDNLFQLGYTSSPEMGQAVLGTE
EHFDQAAKGGTIVSGGRAAANSPPYISDPLSAIQQRAAKDGSWVNWDLSSSNPDVNGATD
VCLVFINAMATEGWDRDGLHDDFSDALILNVASQCANTVVTIHAAGIRLVDQWIEHPNIT
ATIIAHLPGQDSGEALVKLLYGEADFSGKLPYTLAKNESDYTPYKPCGLEEGSKDPQCDF
TEGVYLDYRSFDDRDVAPRFEFGYGLSYTEFEYSDLVVKVAETSASATDDDLWSTFATVQ
ATVSNIGKRDGEEITQLYVAIPNSPPKQLRGFEKVKISQGESAEIPFELARRDLSVWDVV
KQDWTLQSGNYTIFVGSSSRALPLTESFTIEV

Enzyme Prediction     

EC	3.2.1.21:10	3.2.1.37:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	1	165	6.5e-47	0.7592592592592593

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396478	Glyco_hydro_3_C	1.60e-46	245	488	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	1.47e-42	1	274	105	368	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	5.41e-38	3	630	144	764	beta-glucosidase BglX.
395747	Glyco_hydro_3	1.66e-27	1	196	110	314	Glycosyl hydrolase family 3 N terminal domain.
405066	Fn3-like	4.05e-25	553	619	1	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62390.1|GH3	0.0	1	632	133	764
CCT75186.1|GH3	0.0	1	632	136	774
QGJ01413.1|GH3	0.0	1	632	136	776
QGI70523.1|GH3	0.0	1	632	136	776
CEI62445.1|GH3	0.0	1	631	126	756

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZYZ_A	5.45e-151	1	630	97	712	Chain A, Beta-d-glucoside Glucohydrolase [Trichoderma reesei],3ZZ1_A Chain A, BETA-D-GLUCOSIDE GLUCOHYDROLASE [Trichoderma reesei]
4I8D_A	5.61e-151	1	630	98	713	Chain A, Beta-D-glucoside glucohydrolase [Trichoderma reesei],4I8D_B Chain B, Beta-D-glucoside glucohydrolase [Trichoderma reesei]
6JXG_A	4.94e-148	1	627	94	709	Crystasl Structure of Beta-glucosidase D2-BGL from Chaetomella Raphigera [Chaetomella raphigera]
6SZ6_A	4.11e-144	1	624	108	831	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
6JBS_A	8.61e-143	1	629	145	802	Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_B Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_C Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_D Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G4N7Z0|CEL3B_MAGO7	0.0	1	630	133	765	Beta-glucosidase cel3A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=cel3B PE=1 SV=1
sp|A5ABF5|BGLM_ASPNC	3.89e-238	1	630	137	765	Probable beta-glucosidase M OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglM PE=3 SV=1
sp|B8N5S6|BGLM_ASPFN	1.60e-235	1	630	138	768	Probable beta-glucosidase M OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglM PE=3 SV=1
sp|Q2UDK7|BGLM_ASPOR	1.29e-234	1	630	138	768	Probable beta-glucosidase M OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglM PE=3 SV=1
sp|A1D122|BGLM_NEOFI	9.99e-232	1	630	141	769	Probable beta-glucosidase M OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOXG_17167-t26_1-p1.