CAZyme Information: FOXG_16968-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_16968-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
539	DS231735.1|CGC1	60124.77	6.4986

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=DS231735.1:87119-88815(-)

Full Sequence      

MTVVEKLDETNYDYVVVGGGTAGCVIASRLAEKLPYAEILLIEGGANDFKNETILNLKCL
LDLWGAEDYDYGYSSVPQPFGNSNIIHSRAKMLGGCSSHNGGISFVPFDMDMKKWQKMGA
DGWTHAEMVRLFKKLRNNVVPIAEDQRSQITKDWIESCSKLFNVPKVEDFNKQIIRDGRL
TPGTGYVSCTYTPDNNHRSSASVAYIHPILRGDEFRPNLTILHKTWTSKIHVKDQTAVGV
RATTDAGTTHDIYARKEVILCAGAVDTPRLMMLSGLGNRQQLEKLGIEVHQDLPGVGENL
QDHVESMYMWEIKDEVPQDKIVMGSEACMVLRREPENAQGDDGDAIDTMFHMFTVPFDFY
TKTMGYETPKNAFCCIPYNPRPASVGRLYLTSADPKVKPALDQRYFSDEKGYDKASNLWM
LKQARKMAQSEPFRKHLLREIAPGPMITTDDQLCEYGRQVSNTVYHPCGTAKMGDTQRDA
MAVVDASLHVKGIKNLRVADASVFPCMVSINPMITVLCIGERAAELIIADSKTAPRPSL

Enzyme Prediction     

No EC number prediction in FOXG_16968-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	7	533	3.6e-91	0.5145631067961165

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.13e-108	11	536	7	542	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.97e-100	12	527	6	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	4.71e-37	382	523	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	8.58e-26	8	520	53	569	Protein HOTHEAD
366272	GMC_oxred_N	9.51e-25	69	305	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61121.1|AA3_2	0.0	1	539	1	539
QMW36122.1|AA3_2	3.82e-216	8	531	11	533
QRD92907.1|AA3_2	3.82e-216	8	531	11	533
QMW48182.1|AA3_2	3.82e-216	8	531	11	533
BAE65509.1|AA3_2	3.82e-216	8	531	11	533

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	1.89e-96	4	527	6	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	1.89e-96	4	527	6	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	7.42e-96	4	527	6	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
4YNT_A	2.37e-57	7	534	1	571	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZH7_A	3.38e-42	12	527	8	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	9.73e-96	4	527	6	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|B9JBA2|BETA_AGRRK	5.37e-63	13	534	4	532	Oxygen-dependent choline dehydrogenase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) OX=311403 GN=betA PE=3 SV=1
sp|Q6LGH5|BETA_PHOPR	5.82e-62	10	535	3	538	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q47944|SDH_GLUOY	1.01e-61	10	527	3	527	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|A7MFA8|BETA_CROS8	1.82e-61	12	525	3	529	Oxygen-dependent choline dehydrogenase OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000002

TMHMM  Annotations     

There is no transmembrane helices in FOXG_16968-t26_1-p1.