CAZyme Information: FOXG_16943-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_16943-t26_1-p1
• CAZy Family: GT17
• CAZyme Description: glycosyl hydrolase family 17

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302		33551.44	9.9811

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=DS231735.1:23567-24527(+)

Full Sequence      

MKLFGSIGAVAAALMLLPGQALAGQYKGFSMGANRADGLCKYTADWKKDFQTIKSWNKGF
NAVRLYSADDCNTLVKAVPAAKQTGMKILVGVWATDDAHFGRDKAALLKVIKQYGTDWIA
AISVGSEDLYRKDISPNKLAQQIYDVRGMVRQFNKNLKVGHTDTWTAWVDGRNDVVTKAC
DIAITNGFPYWQGVPIKDALRLKTFQNSYWNVQKHVKAVNSKAAVWVGETGWPTKGPNYQ
KAAATTASLQSYYNNVGCWLWQQKDASGFWFTAFDAPLATPEVEKYFGIANKDRKLKFSL
TC

Enzyme Prediction     

No EC number prediction in FOXG_16943-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	49	302	8e-32	0.9421221864951769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	6.82e-60	18	294	37	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.21e-16	28	302	2	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61100.1|GH17	4.00e-229	1	302	1	302
CCT74252.1|GH17	5.02e-223	1	302	1	302
QGI87033.1|GH17	5.02e-223	1	302	1	302
QGJ00576.1|GH17	5.02e-223	1	302	1	302
QGI69688.1|GH17	5.02e-223	1	302	1	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.99e-31	26	301	37	293	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.47e-30	26	301	37	293	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13990|BGL2_SCHPO	1.81e-63	29	302	44	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4
sp|P15703|BGL2_YEAST	7.93e-50	1	302	1	310	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|P43070|BGL2_CANAX	9.76e-42	29	302	24	305	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|Q4WG16|EGLC_ASPFU	1.65e-41	10	302	7	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	1.77e-41	10	302	7	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000231	0.999728	CS pos: 23-24. Pr: 0.9750

TMHMM  Annotations     

There is no transmembrane helices in FOXG_16943-t26_1-p1.