CAZyme Information: FOXG_16561-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_16561-t26_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
513	CM000599.1|CGC12	57186.64	5.6626

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000599.1:234679-236327(-)

Full Sequence      

MEGLKRLLLFTNSDFGQANVVLATAHELGIACEDVEIHIASFQDLRSGVDDASRFMQTTA
AQQKKKTPRPFVFHKIEGTSWGPATKRPETAIFETLELTPGVVNSAKGVAILPAVMIPWS
PREFLDMYKETERVFNEVNPDLTIVEPLFTQGLTFCHYRGARWMVLSPNTIKEFAVPVQP
KLAALWNACSALPYPIPWSLIPWNIYFGFVAGYTLLTDTRLKKTTEILRDEIDPSISLMT
MMELGVLRPAPPNLPILVASSPDIDYPFSIIPPQLTSCGPIIRAAPPIREVDAGLAEWLS
QGSTIYVNLGTHHKSNPTEAHQMSKAFRKVLEHADTLHSAGKPRQILWKLGRVPDEEGNA
PKRDTYTGEWALVTDELQAYIKSDRVRLTDWLVAEPKSVLGSQNIVCSVSHGGANSFYEA
LCSGIPQALLPAWTDCYDFANRVELLGIGLWANKEAKPRWQEDELAEALLEILFGPESAG
MRKRAEEGASRHPEWEGRQMAAQEILNYLMRLG

Enzyme Prediction     

No EC number prediction in FOXG_16561-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	283	507	1.5e-16	0.4162303664921466

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.57e-26	84	508	49	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.63e-15	120	505	36	395	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
215127	PLN02210	7.08e-11	290	487	254	427	UDP-glucosyl transferase
178170	PLN02555	4.74e-08	384	485	337	439	limonoid glucosyltransferase
278624	UDPGT	1.16e-06	263	476	236	409	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60995.1|GT1	0.0	1	513	1	513
CCT74337.1|GT1	0.0	1	512	1	512
QGJ00663.1|GT1	0.0	1	512	1	512
QGI69774.1|GT1	0.0	1	512	1	512
CEI70655.1|GT1	1.43e-288	5	509	5	512

PDB Hits     

FOXG_16561-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A411KZY6|BUAB_ASPBU	2.70e-65	1	487	1	452	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	1.46e-59	7	490	8	476	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|A0A0D1DZV5|EMT1_USTMA	5.53e-14	6	505	2	558	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|Q64676|CGT_MOUSE	1.97e-08	141	511	133	453	2-hydroxyacylsphingosine 1-beta-galactosyltransferase OS=Mus musculus OX=10090 GN=Ugt8 PE=1 SV=2
sp|M9MH90|EMT1_PSEA3	4.96e-08	386	503	443	557	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOXG_16561-t26_1-p1.