CAZyme Information: FOXG_16408-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_16408-t26_1-p1
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358		41530.06	4.6660

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000602.2:1416224-1417431(-)

Full Sequence      

MAKLLAELTPPFGPFPPSFAAPKRYRWAAGLTFTIFIFFLLSNNRFLSQEPLKFHGSIEV
DWSRFAYTQYVTNSDYLCNSVMFFESLHRLSSRADRVMMYPSRMFEADNDSSVDTQLLIK
ARDEYQVKLVPITVQHKDNKDDTWADSFTKLLAFNQTQYSRVLSIDSDSMLLQNMDELFL
LPPVPVAMPRAYWLFPEKELLSSQVMLIQPSDAEFARIMAKVDSASDNDYDMEIVNYLYR
ESALVLPHRPYDLLTGEFRGDNHNRYLGSDTEPWDPAAAYNEAKLVHFSDWPLPKPWIQT
NEELRLQSQPNCTTLSDGAEDCAARIIWNSFYTDFKRKRKEICGLSEVVILSKEEYED

Enzyme Prediction     

No EC number prediction in FOXG_16408-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	65	299	1.9e-22	0.8793774319066148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	4.90e-86	65	335	1	278	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
133018	GT8_Glycogenin	1.83e-21	65	297	1	212	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	9.74e-14	63	217	69	218	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
132996	Glyco_transf_8	3.23e-10	125	297	57	244	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI78920.1|GT8	1.50e-227	14	358	4	348
QGI61733.1|GT8	1.50e-227	14	358	4	348
QGI92632.1|GT8	1.50e-227	14	358	4	348
CCT65566.1|GT8	1.50e-227	14	358	4	348
QKD51705.1|GT8	2.96e-227	21	358	2	338

PDB Hits     

FOXG_16408-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4HVS2|GNT1_GIBZE	1.00e-128	60	343	150	434	Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GNT1 PE=3 SV=2
sp|Q4WBL2|GNT1_ASPFU	4.69e-95	14	340	26	371	Glucose N-acetyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gnt1 PE=3 SV=1
sp|Q59ZI3|GNT1_CANAL	1.07e-27	40	339	45	456	Glucose N-acetyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GNT1 PE=3 SV=1
sp|Q12096|GNT1_YEAST	1.90e-27	60	343	87	489	Glucose N-acetyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GNT1 PE=1 SV=1
sp|Q6BUZ2|GNT1_DEBHA	4.71e-26	27	301	14	403	Glucose N-acetyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GNT1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999992	0.000012

TMHMM  Annotations     

There is no transmembrane helices in FOXG_16408-t26_1-p1.