CAZyme Information: FOXG_15346-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_15346-t26_1-p1
• CAZy Family: GH76
• CAZyme Description: alpha-N-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
261		28055.66	9.1358

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000593.1:483292-484077(-)

Full Sequence      

MKFFSNDLSLFSTGLLLLASVGDVSAQCALPTTYKWTSSGALAQPKSPWVSLKDFTVAPY
NGGQLVYATTYGNGWGSMAFSPVSNLNQLSSATQTGMTSTAVAPTLFFFKPKNIWILAHQ
WGPTKFSYRTSSNPTNPNGWSAAQPLFTGEIANAAYGPIDQTVIGDSKNMYLFFAGDNGR
IYRASMPIGNFPGSFGSQSQIILQDTEDNLFEAVQVYSLQGLNKYLMIVEAKGKNGASSL
FHRNSSMASDVNAVRVTLAAG

Enzyme Prediction     

EC	3.2.1.55:25	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH62	28	237	6.1e-91	0.7697841726618705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281639	Glyco_hydro_62	4.89e-114	28	236	1	211	Glycosyl hydrolase family 62. Family of alpha -L-arabinofuranosidase (EC 3.2.1.55). This enzyme hydrolyzed aryl alpha-L-arabinofuranosides and cleaves arabinosyl side chains from arabinoxylan and arabinan.
350101	GH62	2.37e-86	30	240	1	224	Glycosyl hydrolase family 62, characterized arabinofuranosidases. The glycosyl hydrolase family 62 (GH62) includes eukaryotic (mostly fungal) and prokaryotic enzymes which are characterized arabinofuranosidases (alpha-L-arabinofuranosidases; EC 3.2.1.55) that specifically cleave either alpha-1,2 or alpha-1,3-L-arabinofuranose side chains from xylans. These enzymes show significantly different substrate preference with rather low specific activity towards natural substrates and differ in catalytic efficiency. They do not act on xylose moieties in xylan that are adorned with an arabinose side chain at both O2 and O3 positions, nor do they display any non-specific arabinofuranosidase activity. The synergistic action in biomass degradation makes GH62 promising candidates for biotechnological improvements of biofuel production and in various biorefinery applications. These enzymes also contain carbohydrate binding modules (CBMs) that bind cellulose or xylan.
350092	GH_F	5.30e-21	53	236	1	195	Glycosyl hydrolase families 43 and 62 form CAZY clan GH-F. This glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) includes family 43 (GH43) and 62 (GH62). GH43 includes enzymes with beta-xylosidase (EC 3.2.1.37), beta-1,3-xylosidase (EC 3.2.1.-), alpha-L-arabinofuranosidase (EC 3.2.1.55), arabinanase (EC 3.2.1.99), xylanase (EC 3.2.1.8), endo-alpha-L-arabinanases (beta-xylanases) and galactan 1,3-beta-galactosidase (EC 3.2.1.145) activities. GH62 includes enzymes characterized as arabinofuranosidases (alpha-L-arabinofuranosidases; EC 3.2.1.55) that specifically cleave either alpha-1,2 or alpha-1,3-L-arabinofuranose side chains from xylans. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many of the enzymes in this family display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. GH62 are also predicted to be inverting enzymes. A common structural feature of both, GH43 and GH62 enzymes, is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI92393.1|GH62	1.45e-152	7	236	4	233
QGI61495.1|GH62	1.45e-152	7	236	4	233
QKD51935.1|GH62	4.40e-150	1	236	1	236
QGI78681.1|GH62	8.38e-145	7	236	4	233
CCT65343.1|GH62	9.03e-137	7	223	4	220

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4O8N_A	4.65e-101	26	236	81	293	Crystal structure of SthAraf62A, a GH62 family alpha-L-arabinofuranosidase from Streptomyces thermoviolaceus, in the apoprotein form [Streptomyces thermoviolaceus],4O8O_A Crystal structure of SthAraf62A, a GH62 family alpha-L-arabinofuranosidase from Streptomyces thermoviolaceus, bound to alpha-L-arabinose [Streptomyces thermoviolaceus],4O8P_A Crystal structure of SthAraf62A, a GH62 family alpha-L-arabinofuranosidase from Streptomyces thermoviolaceus, bound to xylotetraose [Streptomyces thermoviolaceus]
6CC7_A	9.46e-101	28	236	20	229	Structure of Fungal GH62 from Thielavia terretris [Thermothielavioides terrestris NRRL 8126]
5UBJ_A	9.59e-98	7	236	6	239	Structure of an alpha-L-arabinofuranosidase (GH62) from Aspergillus nidulans [Aspergillus nidulans FGSC A4]
3WMY_A	2.53e-97	18	236	129	348	Crystal Structure of Streptomyces coelicolor alpha-L-arabinofuranosidase [Streptomyces coelicolor A3(2)],3WMZ_A Crystal Structure of Streptomyces coelicolor alpha-L-arabinofuranosidase ethylmercury derivative [Streptomyces coelicolor A3(2)],3WN0_A Crystal Structure of Streptomyces coelicolor alpha-L-arabinofuranosidase in complex with L-arabinose [Streptomyces coelicolor A3(2)],3WN1_A Crystal Structure of Streptomyces coelicolor alpha-L-arabinofuranosidase in complex with xylotriose [Streptomyces coelicolor A3(2)],3WN2_A Crystal Structure of Streptomyces coelicolor alpha-L-arabinofuranosidase in complex with xylohexaose [Streptomyces coelicolor A3(2)]
4N1I_A	5.74e-93	28	236	10	219	Crystal Structure of the alpha-L-arabinofuranosidase UmAbf62A from Ustilago maidys [Ustilago maydis 521],4N2R_A Crystal Structure of the alpha-L-arabinofuranosidase UmAbf62A from Ustilago maydis in complex with L-arabinofuranose [Ustilago maydis 521]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U7D2|AXHA_ASPOR	1.40e-101	17	236	17	238	Probable alpha-L-arabinofuranosidase axhA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=axhA PE=3 SV=1
sp|Q5B9Z8|AXHA1_EMENI	5.49e-101	14	236	14	238	Probable alpha-L-arabinofuranosidase axhA-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=axhA-1 PE=3 SV=2
sp|Q9UVX6|AXHA_ASPSO	5.67e-101	17	236	17	238	Alpha-L-arabinofuranosidase axhA OS=Aspergillus sojae OX=41058 GN=axhA PE=2 SV=1
sp|Q5AUX2|AXHA2_EMENI	4.48e-97	7	236	3	236	Alpha-L-arabinofuranosidase axhA-2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=axhA-2 PE=1 SV=1
sp|O54161|EABF_STRCO	3.83e-96	18	236	166	385	Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=abfB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000198	0.999758	CS pos: 26-27. Pr: 0.9780

TMHMM  Annotations     

There is no transmembrane helices in FOXG_15346-t26_1-p1.