CAZyme Information: FOXG_15330-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_15330-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
213		21271.19	4.2802

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

Full Sequence      

MELSLLYFLCILSLASASFPFNFGLSSSPVLLPRAKNPTSKDGNCGSNSETNATCLTSTF
GNCCSEKGFCGKTSAYCSEGCQEAFGSCSSSADGQLVSTSGSCGATSTSNITCEGSTYGD
CCSEKGYCGKNATYCGAGCQSMFGTCSSGDESSTTTATSDKTSTSTAASSTSLGAISIDG
NCGSNSDINATCKDSTFGDCCSAKGYCGGTSGK

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
211316	ChtBD1_1	8.58e-06	107	146	4	43	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	1.57e-05	49	88	4	43	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
395135	Chitin_bind_1	0.005	61	82	14	35	Chitin recognition protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD51953.1|CBM18	QKD51953.1|CBM18	2.23e-117	1	194	1	194
QGI78660.1|CBM18	QGI78660.1|CBM18	2.64e-111	1	201	1	201
QGI61474.1|CBM18	QGI61474.1|CBM18	2.64e-111	1	201	1	201
CCT65321.1|CBM18	CCT65321.1|CBM18	2.64e-111	1	201	1	201
QGI92372.1|CBM18	QGI92372.1|CBM18	2.64e-111	1	201	1	201

PDB Hits     

FOXG_15330-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

FOXG_15330-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000309	0.999682	CS pos: 17-18. Pr: 0.9642

TMHMM  Annotations     

There is no transmembrane helices in FOXG_15330-t26_1-p1.