CAZyme Information: FOXG_14708-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_14708-t26_1-p1
• CAZy Family: GH64
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1239		135998.97	6.7687

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000600.1:1913374-1917093(+)

Full Sequence      

MTWHAQLALVLGLVCLASAKCTGMSDDCSSNPIPLRQFNPLNFHATTCNLKWNNGCTRNK
NGQLQQKPPPFLLCNSGQFPSGLIPVDAYTLAMQTRDAGSPQNSAKYTLHGLWPSSAGGN
GARDQPYGCLNGEEFDESILKTFGDLLSYFWPTDPKFGNTMQCFILSEWMKHGTCAVIPG
ADGNAFRLSQEAYFRTAFVLANEFNANAALRQQLDEPGSEDLESNVSTGCVQCAYLATVD
WDGTDVQSVPRMSGDCVNQCFACGDSWDICPPAQLNSTVELDPSNAPVDTTDSGTNSDGL
ANFAVLDFAMPAFISNNTSPWEGTWRSFGVRPNLSCLPCTYPGRPSSWPAREPTPNGTKT
NQPPLDRIHHTLGPKELVLRCGGNRLEECLVQRLPDIGGLEAAFLACNHTGQPAPASFYT
AMDTPGCGNFLMFRCKASAEGCSFSPDATSAASKSKTKTKSGSDFEPTLVSHSQPGIAGA
PTKLLGLWRSLQVSSHYEEGLANWSFTSDGQASVKWPNHPERGVERYSVSHSREDPRKVL
LATASGAITTCRFKFQYQPVYSYAVLDCTAGDKKTQWAMGRCNPCSAECRYSCSAENDNC
GAGSCDPSESSSAGALPSPQVDSNHRWCTPEDSSCWPTKTAIDKLEKALDPAVPRLGVQW
SNYPAPQPAPVPTGSINNQAFYGLGSKGLKALYYYEDIAEMQRPCFNIKDGVNIWNTASD
MCKAALHQNEYRNWNPFIVVFPLNQRHITAALKFAAQHRLCIATAGTGHEYNSRNSCPTG
GILIRTILLKNKEFLPTWSEDPALAPAGAFRFGAGSIFAEIHAFSAKYDRVVASGWCSTV
GMTGYHLGGGHGPFAPSMGLGVDNVLEIEVLQVGRSIHGQTVVHKKTVSRRKNPQLFWAM
RGGGGGVWGVILSMTIRAHAVPDGGLSRVFMSQTGTFCPGSKSKFGYEWLREMWPRFAEW
QLRLNSKVSTQPSFFIDTSKYKKGDLCTATWTFNFEYFYAGGQKEQDYVMFRDSLKDVLQ
TKTMQEDNFNSAYDYLLSMPPNKFQISVMNPLPAPHEPSDDATGSQNSVFVSREDMETKF
ASTMMDVLDICVNSLKTPDKTSPDPMGYRCGFHYLYTSITGNLGSAQPGDTAISPGFRSG
LMLWNARTLSTKQCEDTIYKLGSNSYFSESSYVMHNWTDRYWGEKKYKQLLAVKRAHDPG
NLFWCHHCVGDDPDDAYGNPLGVKKAQDVKVDSYKKDEL

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	726	923	4.2e-40	0.39082969432314413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238220	RNase_T2	3.48e-15	87	219	2	129	Ribonuclease T2 (RNase T2) is a widespread family of secreted RNases found in every organism examined thus far. This family includes RNase Rh, RNase MC1, RNase LE, and self-incompatibility RNases (S-RNases). Plant T2 RNases are expressed during leaf senescence in order to scavenge phosphate from ribonucleotides. They are also expressed in response to wounding or pathogen invasion. S-RNases are thought to prevent self-fertilization by acting as selective cytotoxins of "self" pollen.
396238	FAD_binding_4	1.85e-13	736	871	1	129	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
238512	RNase_T2_euk	1.29e-12	108	213	31	124	Ribonuclease T2 (RNase T2) is a widespread family of secreted RNases found in every organism examined thus far. This family includes RNase Rh, RNase MC1, RNase LE, and self-incompatibility RNases (S-RNases). Plant T2 RNases are expressed during leaf senescence in order to scavenge phosphate from ribonucleotides. They are also expressed in response to wounding or pathogen invasion. S-RNases are thought to prevent self-fertilization by acting as selective cytotoxins of "self" pollen. Generally, RNases have two distinct binding sites: the primary site (B1 site) and the subsite (B2 site), for nucleotides located at the 5'- and 3'- terminal ends of the sessil bond, respectively. This CD includes the eukaryotic RNase T2 family members.
395357	Ribonuclease_T2	3.50e-12	101	212	24	124	Ribonuclease T2 family.
223354	GlcD	7.71e-09	708	870	2	159	FAD/FMN-containing dehydrogenase [Energy production and conversion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	2.01e-18	736	922	598	775
QKD57322.1|CBM91|GH43_11	2.01e-18	736	922	598	775
UNI23960.1|AA7	8.34e-11	736	961	48	244
UPK90596.1|AA7	1.33e-10	736	949	20	215
EGX49222.1|AA7|CBM1	3.38e-10	734	923	162	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	4.58e-22	736	1212	124	561	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6FYE_A	1.59e-12	711	921	20	211	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]
6EO5_A	1.68e-12	719	979	31	262	Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens],6EO5_B Physcomitrella patens BBE-like 1 variant D396N [Physcomitrium patens]
6EO4_A	1.68e-12	719	979	31	262	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]
6FYD_A	3.69e-12	711	921	20	211	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A0E0RTV6|ZEB1_GIBZE	2.50e-24	628	1212	29	550	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2
sp|D4B1Z7|A2478_ARTBC	1.33e-22	736	1212	122	560	Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02478 PE=1 SV=1
sp|L0E2Q5|PHQH_PENFE	2.15e-22	748	923	131	301	FAD-linked oxidoreductase phqH OS=Penicillium fellutanum OX=70095 GN=phqH PE=3 SV=1
sp|G2QDQ9|VAO15_MYCTT	2.35e-21	736	1212	124	561	VAO-type flavoprotein oxidase VAO615 OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=MYCTH_2305637 PE=1 SV=1
sp|A2TBU3|EASE_EPIFI	1.10e-20	747	1218	139	579	FAD-linked oxidoreductase easE OS=Epichloe festucae var. lolii OX=73839 GN=easE PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000193	0.999771	CS pos: 19-20. Pr: 0.9807

TMHMM  Annotations     

There is no transmembrane helices in FOXG_14708-t26_1-p1.