CAZyme Information: FOXG_14516-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_14516-t26_1-p1
• CAZy Family: GH54|CBM42
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
501		55188.38	7.1733

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000600.1:1396954-1398783(-)

Full Sequence      

MPPAEKDPNANGKPSDDEAVIEKAKKEYNKLKSRFDLGRIIPNVILPALVGAAVWARQPS
DNQFTAPPAALRKCLDSVCAGADNCVRYPASGENREYFQWASPFNLGRIVLPAAVVRPST
DEQVSGFVRCAADSNVKVQARSGGHSYANYGVGGLLGDIDDLLDNQKGNRAFPHGVCPGG
GLGPSSRMWGATLDHVVEAKVVTANGTIVTASEAKYPDLFFAIRGAAAGFGIVTQFVIKT
VEKPKKTLHFTHRTPYTNSEGIVEQFKRWREMVADKKLDHRIGTEFALDPEGSKITATWF
GTRQDFDQSGIAERLGLKLTPVESSWVNTKRWQYENAVLTLSDIPTEFFSRSLGFTADDA
TSFNATERLVQLIAANKSQSKLKWFCIFDATGGKVAEPAMDSTAYAHRDKVMFYQSYLYN
IWAPLTADEKGLLSGIHETIVGGIPTRSPSTYPGYIDPLLENPQEAYWGPNLDRLEAIKR
EWDPEDVFHNPQSVRPAKLKL

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	156	494	5.1e-42	0.8100436681222707

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	4.38e-14	110	497	30	459	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	1.77e-12	112	212	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
369658	BBE	1.45e-11	451	495	1	45	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	5.99e-09	107	246	58	244	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI23960.1|AA7	9.51e-111	71	498	9	473
QUC19098.1|AA7	8.86e-105	71	497	9	471
CCA70426.1|AA7	5.17e-101	71	497	54	518
QRD00400.1|AA7	3.65e-94	103	498	37	476
AHG26149.1|AA7	5.91e-92	70	500	5	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K8E_A	1.77e-54	45	499	3	497	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
3RJ8_A	8.01e-49	96	498	21	473	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
1ZR6_A	1.38e-47	104	496	35	478	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
6Y0R_AAA	2.13e-46	104	496	53	490	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
6YJO_A	2.18e-46	63	497	27	504	Chain A, FAD-binding PCMH-type domain-containing protein [Fusarium graminearum PH-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6HNK6|SORD_PENRW	1.68e-59	69	496	5	469	FAD-linked oxidoreductase sorD OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=sorD PE=3 SV=1
sp|G2QG48|XYLO_MYCTT	9.10e-54	45	499	3	497	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	6.27e-48	72	498	22	495	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2
sp|Q6PW77|GOOX_SARSR	6.63e-47	104	496	54	497	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1
sp|I1S2K2|CHITO_GIBZE	1.09e-45	104	496	53	490	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999820	0.000183

TMHMM  Annotations     

There is no transmembrane helices in FOXG_14516-t26_1-p1.