CAZyme Information: FOXG_14328-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_14328-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527		56210.77	4.5718

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000603.1:919840-921469(-)

Full Sequence      

MWATRNHCHGLLGGLAILTKLVDASGLAMFPQGSLSSAGLSSVCEATLYQSINCADETAD
LAANGYLDSDDPAVTKLVCRSTCGSAIGHMRTKVASACGTEEMVPGMSYVHMVDKLWGSW
NQTCFTDPKTGEFCHGKYVIAAFPEVDDVSKLSKSDLCSYCNVEQYKIMQADAYSGAYDE
YAQSNYKYVAKACDLKVDNFNPTDSAFNVTNPDASSEVCVSGKTYGAKAGDSCDSIALSQ
GVSAATMYYINSNIFDCTKIAVGTSLCLPLTCTKIYRVQKGDTCLDIALNNGIMSDQLLS
YNSQLNWNCTNLHDADPYWGSTLCVSTPGGIYAGQPLNNNTANTDPQRIDPPAGATVANG
TTLECSHWLTYDGGLSCTQICLANDVAINLFTEINPSLNKTTCDEDLKAGNAYCVKPITG
WDLPAFTKTATGQATATKSASPSGTKSTAATASAPQTSTSEKVPSPTQPGIVDSCNQWHY
VDNGDGCYSIAETYHINLADFYKWNSKVGNDCSGLWLHYYVCVGVAS

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
212030	LysM	1.35e-08	477	521	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	2.72e-06	274	312	1	39	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
237555	PRK13914	3.32e-05	424	506	147	229	invasion associated endopeptidase.
396179	LysM	4.41e-05	276	325	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
197609	LysM	1.12e-04	224	268	1	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD59081.1|CBM50	0.0	1	520	1	488
QKD61253.1|CBM50	0.0	1	520	1	488
CZS74850.1|CBM50	0.0	1	527	1	525
CEF83616.1|CBM50	1.09e-317	1	527	1	525
APA07678.1|CBM50	1.04e-172	25	525	43	527

PDB Hits     

FOXG_14328-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	1.09e-22	272	525	155	373	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4AVW3|LYSM5_ARTBC	1.89e-21	40	527	48	538	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2
sp|D4B5F9|PGDA_ARTBC	4.87e-14	467	525	379	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2
sp|D4B4P8|LYSM2_ARTBC	8.16e-10	365	525	29	181	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AZ68|LYSM3_ARTBC	1.19e-08	464	525	347	408	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002005	0.997972	CS pos: 24-25. Pr: 0.9539

TMHMM  Annotations     

There is no transmembrane helices in FOXG_14328-t26_1-p1.