CAZyme Information: FOXG_14258-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_14258-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
609		65300.92	8.2126

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000602.2:830929-833119(+)

Full Sequence      

MPKLQALTLAALSCLHATTASAYPRQDVNLRTEYDYIIVGAGASGLTVANRLSEDPAVTV
LVIEAGDFDKNEDIVTIPGLAGNAVGTKYDWNLTYPSTTSLNGRNISIPLGKVVGGSTKL
NRMVYDRGSQADYDRWAELGNGDWQWKTLLPYFKKNEKFTGPTAGIKKEYGITTDPSAHG
SSGYIHSSYSPFFWPTTKNLVEATGELDINIAVDQANGGAIGGYFCPHNLNRETLVRSSA
QDYYSAVSQRRNLQLLPGHQVTRVLTSKNGSSVRANGVEFAKNRDSAKKTLKAKKEVILA
AGAVHTPQILQVSGIGDSALLSSIDVPVVVDLPAVGQNFHDHVFLAVVSTIDAPIQGSNL
TKNATFAAEARAEYDQQKKGPLTSPTADFLLFLPLSNYTSAASDIHKQATGQDGSKFLPT
GTPAEVVKGYKKQQKVLNEKLLDTQSAILEIIWADGTSVLGLQHPYSRGYVKAKSSNIFD
SPEANPEFLKNPLDLAILAEGVKFARKLSGAPSIKALNPFELVPGANVTSDSDLEQFIRS
SASTLFHPAGSCKLGSRSEGGVVDEKLRVYGIKGLRIVDASVMPLLPATHTMTTVYAVAE
KAADLIKSG

Enzyme Prediction     

No EC number prediction in FOXG_14258-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	33	608	8e-188	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.05e-110	27	608	1	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.99e-104	33	607	5	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	4.29e-44	465	602	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	9.74e-33	97	342	10	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.88e-25	20	595	37	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKC01502.1|AA3_2	0.0	1	609	1	609
QKD60653.1|AA3_2	0.0	1	609	1	609
QGJ00970.1|AA3_2	0.0	1	609	1	609
CCT74664.1|AA3_2	0.0	1	609	1	609
QGI70079.1|AA3_2	0.0	1	609	1	609

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	6.33e-109	29	607	1	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	4.29e-97	7	606	4	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
5OC1_A	1.33e-83	33	608	1	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	7.37e-83	33	608	2	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	2.59e-81	7	606	13	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5GMY3|GMCH_MALSM	1.84e-110	6	606	13	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	1.84e-110	6	606	13	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5AUN2|XPTC_EMENI	1.13e-101	16	607	24	614	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	6.07e-86	6	607	3	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q0R4L2|PDH3_LEUMG	4.21e-83	4	606	12	595	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000779	0.999193	CS pos: 22-23. Pr: 0.9644

TMHMM  Annotations     

There is no transmembrane helices in FOXG_14258-t26_1-p1.