CAZyme Information: FOXG_13254-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_13254-t26_1-p1
• CAZy Family: GH43
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481	CM000600.1|CGC18	55016.55	5.6215

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000600.1:502154-503707(+)

Full Sequence      

MPSLPKDFQLGFATASYQIEGAVAEDGRGPSIWDVFCHLEPTRTKGANGDVACDHYHRLE
EDLDLLKRYGSDMYRFSISWSRVIPLGGRDDAINEAGIAFYNRVIDGCLKRGITPWVTLY
HWDLPQALHERYGGWLDVEESQKDFERYARLCYERFGDRVKHWITLNEPWIVSIFGYATG
GNAPGRSSINPQSTEGDTSTEPWIVGKALIMSHARAVAAYNQDFRPSQKGQIGISLNGDY
YEPWDSSDPRDSEAAERRMQFHIGWFANPIFLGQDYPKCMRDQLKDRLPHFTSDDLKLLR
SAESDFYGMNYYTSQFARHKSSPAPDTDYIGNLDELQTNKAGEPVGLESGLHWLRSCPDL
FRKHLTRVYRLYGKPIIITENGCPCPGEDKMTREESVQDEYRIKYFEDHLDAIGRSVGED
GSVVEGYFAWSLMDNLEWSDGYGPRFGVTFTDYKTLERTPKKSALVLRQLVDHRKGSQLK
L

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	474	1.1e-159	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	3.35e-171	3	471	4	448	Glycosyl hydrolase family 1.
274539	BGL	6.18e-165	5	465	1	424	beta-galactosidase.
225343	BglB	1.46e-150	1	474	1	453	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
184102	PRK13511	1.72e-101	1	475	2	467	6-phospho-beta-galactosidase; Provisional
215435	PLN02814	2.96e-101	3	464	27	473	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61576.1|GH1	0.0	1	481	3	483
CEF83492.1|GH1	0.0	1	481	1	481
QPC64692.1|GH1	0.0	1	481	1	481
CZS73216.1|GH1	0.0	1	481	1	481
QPC73585.1|GH1	0.0	1	481	1	481

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JBO_A	8.08e-287	3	470	7	474	Trichoderma harzianum GH1 beta-glucosidase ThBgl2 [Trichoderma harzianum]
6KHT_A	5.37e-285	3	470	20	487	Chain A, Glycoside hydrolase family 1 [Trichoderma reesei QM6a],6KHT_B Chain B, Glycoside hydrolase family 1 [Trichoderma reesei QM6a],6KHT_C Chain C, Glycoside hydrolase family 1 [Trichoderma reesei QM6a]
4MDO_A	1.99e-181	3	472	25	493	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	1.82e-176	4	472	3	460	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
3AHY_A	1.89e-175	4	472	9	467	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	9.49e-174	4	469	11	469	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	1.41e-156	4	464	6	449	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q9SPP9|RG1_RAUSE	1.86e-139	5	467	23	507	Raucaffricine-O-beta-D-glucosidase OS=Rauvolfia serpentina OX=4060 GN=RG PE=1 SV=1
sp|Q8L7J2|BGL06_ORYSJ	1.85e-137	3	471	49	519	Beta-glucosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU6 PE=1 SV=1
sp|Q9FZE0|BGL40_ARATH	4.77e-135	3	463	36	498	Beta-glucosidase 40 OS=Arabidopsis thaliana OX=3702 GN=BGLU40 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOXG_13254-t26_1-p1.