CAZyme Information: FOXG_13164-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_13164-t26_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
598	CM000600.1|CGC5	63960.03	9.2637

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000600.1:272020-273971(-)

Full Sequence      

MLVKLHLWFSLAAAAVAAPSKDAYDYIVVGGGTAGVAVAARLSEGLPSANILLIEAGPAA
HDEPKINIPGMKGSTLGTKYDWNFTTVPQTGANNRVWPINRGKVLGGSSALNLMTYDRAA
VAEYDAWQALGNPGWNWKTMIKAMMKSETFTGKNTATYGSKGVGDSGPVKAVVNRIIPKH
QESWIPTLNKLGVRKNLESLGGNPLGVMYQPSSIDPSNYNRSYSANAYTEISGPNLEILA
DTIVAKINVSGPAAKKKAIATGVTLQDGTYVKARREVILSAGSIQSPGLLEQSGIGSKSV
LSAAGIKQIIDLPGVGENLQDHLRVMTSYQLKPEFLSFDALRSNATFAAEQLALWNAGKR
SLYDYTGSAYTFSTWKQALGSDAKLVSLAKDAAGKDASNVDKKKLDFLKDSSVPQVEVIF
SDGYTGVKGYPAATSPLFGKGFVTLIGVVMHPLSRGSVHINPSDPAGKPTINPNYLSNPH
DVEAVFQTVKYNRKIANTEPMRSIWEDEYEPGLDVKTDEQIKDYVLRTTLSIFHPSGTCA
MLPKADGGVVDAKLKVYGTENLRVVDASVIPLLISAHIQTAVYGIAEIAAELIIKDAK

Enzyme Prediction     

No EC number prediction in FOXG_13164-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	23	596	7.5e-185	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	7.19e-96	24	598	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	4.19e-94	24	593	6	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	7.57e-44	452	587	1	141	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.06e-25	92	323	14	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	3.73e-16	23	569	55	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61481.1|AA3_2	0.0	1	598	1	598
CEI62186.1|AA3_2	0.0	1	598	1	598
CZS81759.1|AA3_2	0.0	1	598	1	598
CEF78466.1|AA3_2	0.0	1	598	1	598
QPC70868.1|AA3_2	0.0	1	598	1	598

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	5.95e-84	24	598	6	569	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	2.00e-77	24	596	6	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	4.98e-73	21	596	33	641	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6XUT_A	6.16e-70	24	593	17	587	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
5OC1_A	9.89e-68	24	596	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5GMY3|GMCH_MALSM	1.09e-96	24	594	47	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	1.09e-96	24	594	47	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.09e-81	20	596	36	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	8.05e-81	21	596	11	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	6.42e-79	24	596	14	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.003597	0.996370	CS pos: 17-18. Pr: 0.9501

TMHMM  Annotations     

There is no transmembrane helices in FOXG_13164-t26_1-p1.