CAZyme Information: FOXG_12964-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_12964-t26_1-p1
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
751		82566.99	6.2395

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000597.1:2992829-2995084(+)

Full Sequence      

MKSVTPPTLLHHHHPVGRENHQPLTFAKAVKEVSFGHDPSAVASRLLTELSLTERLHLLD
GDVPFWEGLRGILCDRYNRKPFVMGAIPRLNIPGVKFTDGPRGVVMGSSTAFPISMARGA
TWDIELERRVGNAIGLEAKAQGANYFAGVCINLPRHPAWGRIQETYGEDPFLLGEFGVAL
TQGVQNHVMACVKHFALNSMENARFRVDVEIEEDVLHEVYLAHFRRVVEAGVASVMSSYN
SVNGEWAGQSKALLTNILREQWKFTGFVMSDFIFGLRDAALSVKNGLDIEAPFAQQRAMH
LENALRSGELSWIDVNKSATRILRTQLKFASRFLSETPDASVVFCKEHRQLAREVAERSI
VLLKNNTINSTPLLPLNEADVTRLALIGRLANKPNTGDKGSSQVFSPTVVTPYQGLKDGI
SNAEIILDDGDSPESAAISAEKADVAVVVVGYDASDEGEFVVPSLQNDPRLSELFPPAKN
SDQKEMLSIVQGNPSQDKQSSTSALEVGAGGDRLSLRLRPQDVEIINAVASVNSKTIVVL
ICAGAVIMEEWKDKVPAIMISWYAGAEGGHALADVLLGRVNVGGRLPFSIPQDESHLPDL
DIEASAIKYDRWYGQSLLDKLGVDAAFPLGYGLSYTEFRFSNLEFEPRMESTGCNSVKVA
VDVKNTGQRSGHHVAQVYGYPNMAEYPHRVLLGFGSVYLRAGELRRIFVDASLRPIERWV
DSQFCLLVDHFQIEVAAYAGDKHGVRKMCQL

Enzyme Prediction     

No EC number prediction in FOXG_12964-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	86	291	5.1e-61	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	6.93e-71	89	707	101	721	beta-glucosidase BglX.
224389	BglX	6.89e-63	86	420	54	387	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	4.10e-60	85	703	74	734	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	2.35e-48	360	635	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.09e-41	89	324	63	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD58937.1|GH3	0.0	1	751	1	751
QGI96189.1|GH3	0.0	1	751	1	746
QGI65307.1|GH3	0.0	1	751	1	746
CCT69478.1|GH3	0.0	1	751	1	746
QGI82556.1|GH3	0.0	1	751	1	757

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	5.82e-76	45	707	7	623	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	3.70e-71	44	737	5	700	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	4.91e-70	44	737	5	700	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	3.29e-65	45	714	8	797	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
5XXL_A	2.84e-62	61	703	55	704	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7LXS8|BGH3A_BACO1	3.74e-77	77	744	63	739	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
sp|P14002|BGLB_ACET2	3.00e-75	45	707	7	623	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
sp|P27034|BGLS_RHIRD	5.85e-73	46	702	5	760	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q5BFG8|BGLB_EMENI	1.36e-65	38	721	7	807	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|F6C6C1|APY_BIFBA	2.47e-64	92	722	37	642	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOXG_12964-t26_1-p1.