CAZyme Information: FOXG_12939-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_12939-t26_1-p1
• CAZy Family: GH32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
300	CM000597.1|CGC19	32856.16	8.7401

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000597.1:2925699-2926750(+)

Full Sequence      

MQLTSIISFWLLALFSTVLGAEVVPRGQLKEVTSYGNNPTGTKMFLYVPKNLKSNPAVVV
ALHYCTGTAQAYYQGTKWASNAEKYGFIVVYPQTPYTPGNCWDVSSKMTLKHEGGGCSTS
IANMAKFVLKEYNGDAKKVFVTGESSGAMMTNVMLATYPDVFAAGSAYAGVPAGCFVSQQ
NQAAAWNSTCSQGKSIYTQTQWANVVKNMYPGYNGPRPKFQIYHGTADPTLNVQNYYEEI
KQWTGVFGYSSNPQSSTPNTPASPFTRQVFGEKFQAFLGQGITHGVPHFDDNDLKWFGII

Enzyme Prediction     

EC	3.1.1.72:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	42	233	3.2e-23	0.762114537444934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	6.41e-48	44	257	1	208	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	5.90e-24	31	267	36	254	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	9.69e-22	46	235	5	187	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
226584	COG4099	8.82e-06	43	170	175	302	Predicted peptidase [General function prediction only].
395257	Peptidase_S9	2.63e-05	125	171	52	98	Prolyl oligopeptidase family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD58910.1|CE1	6.91e-229	1	300	1	300
QGI84699.1|CE1	2.39e-209	1	300	1	299
QGI67473.1|CE1	2.39e-209	1	300	1	299
CCT71718.1|CE1	2.39e-209	1	300	1	299
QGI98355.1|CE1	3.96e-208	1	300	1	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	3.90e-112	27	298	2	273	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NBI2|AXE1_ASPFN	2.00e-121	20	298	25	304	Probable acetylxylan esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=axeA PE=3 SV=1
sp|Q75P26|AXE1_ASPOR	1.15e-120	20	298	25	304	Acetylxylan esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=axeA PE=1 SV=1
sp|A9JPE6|AXE1_ASPFL	1.15e-120	20	298	25	304	Probable acetylxylan esterase A OS=Aspergillus flavus OX=5059 GN=axeA PE=3 SV=1
sp|A1DBP9|AXE1_NEOFI	1.57e-120	9	298	11	303	Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=axeA PE=3 SV=1
sp|Q4WBW4|AXE1_ASPFU	3.48e-120	9	298	11	303	Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000233	0.999741	CS pos: 20-21. Pr: 0.9820

TMHMM  Annotations     

There is no transmembrane helices in FOXG_12939-t26_1-p1.