CAZyme Information: FOXG_12527-t26_2-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_12527-t26_2-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
502		54981.44	8.0704

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000591.1:966472-968199(-)

Full Sequence      

MHICFGGPKLLLRTFHSHSADRVNNLLTTDPKCDALTNIPQLKNKVYMPETTQYEQRLKT
YYSANAALEPWCMVMPESTQDVSRVATVVSKHSCPFGSRSGAHSAFRGANGVKDGITIDF
GHMNATVYDAKHKLAKIQPGSNWGHVYEALDPYGVAAVGGRASVVGVGGFVTGGGYSFHT
NVKGFACDQVVNFEVVLADGKIVNANRKQNPDLWKALKGGSGNVGFVTRIDQRVVSSNQL
WGGFIVFDLAQRHAVFDTYIKFVEVNEEDAASQLIVSVQYDGKQRLLLSVVSNSDAVESP
TAFSPLLSIPNTSNTLTRGKIADLVPQFTGPTPLGLYANWMTGMTANDIRIMKFMDEKHE
EYVGKMKAAAPGSDFSILVQFQPVTALMVSHARENGGNVLGLEDVTADGPTLMWLIAVTV
DTAENQEKIYPLTLEYRAAVNAYATAIGINKNWEYLNYALGDQNPLSHYGARNIQTMRRA
SKKYDPHGVFQRLRASGFKIPE

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	60	491	3.5e-55	0.9781659388646288

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	2.12e-19	76	490	38	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	2.09e-16	74	206	5	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
178402	PLN02805	7.04e-08	39	234	99	304	D-lactate dehydrogenase [cytochrome]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO16207.1|AA7	7.36e-20	62	228	120	287
EGX49222.1|AA7|CBM1	2.52e-19	27	227	125	323
ADI58761.1|AA7|1.1.3.-	1.23e-17	60	490	27	464
UPL01114.1|AA7	3.18e-17	60	380	53	375
CDR44461.1|AA7	4.69e-17	42	229	40	230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3HSU_A	8.61e-19	60	490	33	470	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]
1ZR6_A	2.72e-18	60	490	33	470	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
3RJ8_A	4.27e-17	48	227	16	197	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]
6FYD_A	1.73e-16	43	231	19	205	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6Y0R_AAA	1.93e-16	48	491	36	483	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A0U5GQ05|DRTC_ASPCI	4.50e-93	44	500	55	513	FAD-dependent monooxygenase drtC OS=Aspergillus calidoustus OX=454130 GN=drtC PE=1 SV=1
sp|C8VPE5|SDCF_EMENI	1.81e-86	26	500	1	476	FAD-dependent monooxygenase sdcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sdcF PE=1 SV=1
sp|M2T7Z1|TPCD_COCH5	2.27e-62	69	500	78	517	FAD-dependent monooxygenase tpcD OS=Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O) OX=701091 GN=tpcD PE=1 SV=1
sp|A0A2G5ICA0|CTB5_CERBT	8.33e-58	33	502	45	526	FAD-dependent monooxygenase CTB5 OS=Cercospora beticola OX=122368 GN=CTB5 PE=3 SV=1
sp|A0ST43|CTB5_CERNC	8.46e-51	60	502	3	458	FAD-dependent monooxygenase CTB5 OS=Cercospora nicotianae OX=29003 GN=CTB5 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOXG_12527-t26_2-p1.