CAZyme Information: FOXG_12251-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_12251-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
566		63374.92	6.9944

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000601.1:977509-979516(+)

Full Sequence      

MVHKPIPSPSSASDAVRWEETDVLIVGSGPIGATFAHTLVKKGIKVTMIDIGQQETRRIG
DHKKNSVAVQKDISLFTNETLTHSVPRENCTHSLCQLTRRDLSWNRPPGLLGRVMHSHDR
DYAKIKRPTDSAYVLNGQNPDQKSYGNLPAAAATRVVGGMGSHWTCCTPRQHKGIERSDL
FSDGEWNTLYGRAEKLFTKTDDAFDDSVRQKLVKRVLTEAYPDREMKSMPLACKRKHDNK
EYVEWSCTATILGELSKPEYFYKGEERLFDMRPNTQCDKLELDPDGQIAWALINDLEANQ
QYYIHAKKYVVCAGAVLTPGILHKSGLKPRLPALGHYLTEQPMAFCQVVLDRKLVNSVEG
EDVVKAHRESHGNDPLPFPFNDPDPQVYFPLSEKYPWHTQIHRDAFGYGEVPSNIDQRLV
VDLRWFGYMKPDQENYVTFSNKTKDQFGMPQPTFNFVLDEEADERCKRMITDMIEVARKL
GGFLPGAEPKYLAPGSALHICGTYRAGSTPADSVVNKNGKAWGVNDLVLGGCGVIPTQNA
CNPTLTAACFALAAADKIIEDLHVDQ

Enzyme Prediction     

EC	1.1.3.10:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	19	562	2.4e-220	0.9981785063752276

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274143	pyranose_ox	6.32e-177	21	546	1	530	pyranose oxidase. Pyranose oxidase (also called glucose 2-oxidase) converts D-glucose and molecular oxygen to 2-dehydro-D-glucose and hydrogen peroxide. Peroxide production is believed to be important to the wood rot fungi in which this enzyme is found for lignin degradation.
398739	GMC_oxred_C	3.66e-15	431	546	1	135	GMC oxidoreductase. This domain found associated with pfam00732.
225186	BetA	1.37e-11	19	546	6	521	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	1.50e-05	273	342	146	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
223717	FixC	7.54e-05	19	63	2	42	Dehydrogenase (flavoprotein) [Energy production and conversion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62719.1|AA3_4	0.0	1	566	1	545
CCT76068.1|AA3_4	0.0	1	566	1	545
QGI70943.1|AA3_4	0.0	1	566	1	545
QGJ01833.1|AA3_4	0.0	1	566	1	545
QGI88281.1|AA3_4	0.0	1	566	1	545

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BG7_A	2.76e-116	5	558	32	609	Chain A, Pyranose oxidase [Trametes ochracea],3BG7_B Chain B, Pyranose oxidase [Trametes ochracea],3BG7_C Chain C, Pyranose oxidase [Trametes ochracea],3BG7_D Chain D, Pyranose oxidase [Trametes ochracea],3BG7_E Chain E, Pyranose oxidase [Trametes ochracea],3BG7_F Chain F, Pyranose oxidase [Trametes ochracea],3BG7_G Chain G, Pyranose oxidase [Trametes ochracea],3BG7_H Chain H, Pyranose oxidase [Trametes ochracea]
1TT0_A	3.88e-116	5	558	32	609	Crystal Structure of Pyranose 2-Oxidase [Trametes ochracea],1TT0_B Crystal Structure of Pyranose 2-Oxidase [Trametes ochracea],1TT0_C Crystal Structure of Pyranose 2-Oxidase [Trametes ochracea],1TT0_D Crystal Structure of Pyranose 2-Oxidase [Trametes ochracea],2IGK_A Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_B Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_C Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_D Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_E Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_F Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_G Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_H Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea]
3BLY_A	3.88e-116	5	558	32	609	Chain A, Pyranose oxidase [Trametes ochracea]
3BG6_A	3.88e-116	5	558	32	609	Chain A, Pyranose oxidase [Trametes ochracea],3BG6_B Chain B, Pyranose oxidase [Trametes ochracea],3BG6_C Chain C, Pyranose oxidase [Trametes ochracea],3BG6_D Chain D, Pyranose oxidase [Trametes ochracea],3BG6_E Chain E, Pyranose oxidase [Trametes ochracea],3BG6_F Chain F, Pyranose oxidase [Trametes ochracea],3BG6_G Chain G, Pyranose oxidase [Trametes ochracea],3BG6_H Chain H, Pyranose oxidase [Trametes ochracea]
4MOG_A	5.13e-116	5	558	32	609	Pyranose 2-oxidase V546C mutant with 3-fluorinated glucose [Trametes ochracea],4MOH_A Pyranose 2-oxidase V546C mutant with 2-fluorinated glucose [Trametes ochracea],4MOP_A Pyranose 2-oxidase V546C mutant with 3-fluorinated galactose [Trametes ochracea],4MOP_B Pyranose 2-oxidase V546C mutant with 3-fluorinated galactose [Trametes ochracea],4MOP_C Pyranose 2-oxidase V546C mutant with 3-fluorinated galactose [Trametes ochracea],4MOP_D Pyranose 2-oxidase V546C mutant with 3-fluorinated galactose [Trametes ochracea],4MOQ_A Pyranose 2-oxidase V546C mutant with 2-fluorinated galactose [Trametes ochracea],4MOQ_B Pyranose 2-oxidase V546C mutant with 2-fluorinated galactose [Trametes ochracea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B2E9|P2OX_EMENI	1.37e-135	16	558	18	574	Pyranose 2-oxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=p2ox PE=3 SV=2
sp|Q75ZP8|P2OX_LYOSH	3.46e-125	22	562	37	603	Pyranose 2-oxidase OS=Lyophyllum shimeji OX=47721 GN=p2ox PE=2 SV=1
sp|Q8J136|P2OX_PENSG	1.11e-114	5	558	32	609	Pyranose 2-oxidase OS=Peniophora sp. (strain SG) OX=204723 GN=p2ox PE=1 SV=1
sp|Q6QWR1|P2OX_PHACH	2.94e-114	19	559	12	613	Pyranose 2-oxidase OS=Phanerodontia chrysosporium OX=2822231 GN=p2ox PE=1 SV=1
sp|P79076|P2OX_TRAVE	4.37e-114	5	558	32	609	Pyranose 2-oxidase OS=Trametes versicolor OX=5325 GN=P2OX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000019	0.000038

TMHMM  Annotations     

There is no transmembrane helices in FOXG_12251-t26_1-p1.