CAZyme Information: FOXG_11986-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_11986-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
673		72560.37	6.4412

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000601.1:303285-305400(-)

Full Sequence      

MRLSFVITCISVLADSASAFSVPWSPSPKSHNPFIGKRDTAVEYDYVVVGSGAGGGPVAA
NLAVAGFKVLLIDAGGDSGDDWVEKVPALHLMSTEFEDTRWNYFVNHYPDAEQQKKDSKM
VYQKTDGSYYVGLTPPKDAKPLGVLYPRAGTLGGCTRHNALITIAAHDSDWSYIASLTGD
DSWNPDNMRSYFEKLEKNMYLPSSIIGHGFNGWLGTSLTSLSLVVEDQKLLSLIISAASA
MGKGLLGFVLNTVAGLGQVLLRDLNAPGQTSKTGLYQVPLSMADSVRGGPRDFILNTAKA
VNKDGSRKYHLDIKLNTLVTKINFDKSGSKPRAVGVNYMQGASLYRADPRSGSAKPTGTG
SVKAKREVIISAGSFNTPQLLKLSGIGPKKELDSFKIPVLVDLPGVGTNMQDRYENTVIG
KTNSDFVITSKCTFLETMPDPCLEQYKKGLGPITKGVYATNGIAIAVVLKSSVAEDEPDL
LISGAPAKFKGYFPGYAADSLADAEHWAWIILKAHSRNNAGTVTLKSTDPRDMPIINFNY
FDTGVNANGEGDKDLQATYEGFEFARKAFDDLIPLDGEFPEVWPGSQTNNEQKAKQFLKD
EAWGHHASCTAAIGADDDPMAVLDSEFKVRGTEGLRVVDASVFPKIPGFYIALPLYIVAE
KASDVIIKAAKSS

Enzyme Prediction     

No EC number prediction in FOXG_11986-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	43	668	9.1e-93	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.59e-57	311	666	216	531	choline dehydrogenase; Validated
225186	BetA	4.04e-55	62	671	26	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	6.59e-30	515	662	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.60e-26	311	648	235	558	Protein HOTHEAD
366272	GMC_oxred_N	2.65e-14	144	415	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62988.1|AA3	0.0	1	673	1	673
QGI88513.1|AA3	0.0	1	673	1	668
CCT75924.1|AA3	0.0	1	673	1	668
QGJ02071.1|AA3	0.0	1	673	1	668
QGI71178.1|AA3	0.0	1	673	1	668

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	4.10e-37	40	669	37	600	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5OC1_A	5.96e-31	43	666	1	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.60e-30	43	666	2	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
3NNE_A	9.54e-30	43	666	13	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	9.54e-30	43	666	13	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8UH55|BETA_AGRFC	4.94e-41	42	664	1	523	Oxygen-dependent choline dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=betA PE=3 SV=2
sp|Q4K4K7|BETA_PSEF5	1.59e-40	41	664	2	531	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=betA PE=3 SV=1
sp|C3K3D3|BETA_PSEFS	5.41e-40	43	664	4	531	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=betA PE=3 SV=1
sp|Q5B8A1|PKFF_EMENI	3.06e-39	44	668	41	609	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q7MF12|BETA_VIBVY	3.10e-39	44	667	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000896	0.999095	CS pos: 19-20. Pr: 0.9627

TMHMM  Annotations     

There is no transmembrane helices in FOXG_11986-t26_1-p1.