CAZyme Information: FOXG_11801-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_11801-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
820		89342.06	4.9027

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000598.1:2458286-2460850(+)

Full Sequence      

MDVQATLKTLSLQEKVRLLSGTPDDFVSIAGIPEKGIAPLKTADSISGIRPSEFNSTLTT
ACFPNTACIASTWNTELLEKMGAELTRQAKIKHAQMILGPTINIQRDPRAGRNFECFSED
PLLSGFMAAAIVNGIQSKGYGACAKHFVCNDSETQRRYYNVDESPNGRALREIYLAAWSF
LLRKSNPAGVMTAYNKVNGAFCCDSETLIEDILRKEWGYKGIVMSDWFGTRSTVAAMKAG
VDVEMPVPVFRGERLIKAVTSGEISEEVIDASVSRLLDLRNRTQAAQSEGPEKSEIIQET
NDIARKLAQEGIVLLKNENQTLPLPAATGLRIGVVGEYAKKAVFTGGGSASCNPQYRQVP
LDLLREALSNEHTVSYASGVRMRRIIPTVPTEIVTTDKGKKGVEVTYHNSGQDEPVLVET
LEDAAINLMAQGKPGLKTPGSHVKMTTNLVPETTGTHTLAVRHSGSFTVEVNGICVLKGG
APDITTEQFLFNLIKLESRIELPMEAGKSYHISVTMQSRESVVGEPTPYGLTLSFEEEYS
EEQAILDAIEVAKTSDITIIYAGRSEQYESEGFDLDEITLPANQVAMIKAVAAASKKTAV
LLHCGNPIDISSFVDDVDAVVNMHFPGQEGPQAMVDILTGKVNPSGRLTATWFKTLQDWP
SFGNFPAQKDEGGGFTIKYVEGLEIGYRGRVPESRVQFPFGHGLSYTSFSYDGLNARLDA
SSNSSILTISVSVTNTGSIAGKEVVQVYICPPQNGADWRPTRELKGFTKVQLSPGETREV
FVQIEVDTFNSHWSEDSHAWAVDEGEYGVEVGDQRATLMI

Enzyme Prediction     

No EC number prediction in FOXG_11801-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	246	6.1e-58	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.82e-66	63	812	120	751	beta-glucosidase BglX.
224389	BglX	1.04e-60	25	352	48	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	2.88e-47	4	787	54	743	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	3.01e-42	540	706	76	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	6.68e-37	63	279	88	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60029.1|GH3	0.0	1	820	1	820
CCT73941.1|GH3	0.0	1	820	1	811
QGI86914.1|GH3	0.0	1	820	1	811
QGJ00445.1|GH3	0.0	1	820	1	810
QGI69557.1|GH3	0.0	1	820	1	810

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.15e-131	2	812	5	822	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.85e-128	2	812	5	822	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	5.69e-111	1	820	3	662	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.55e-108	6	812	8	649	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	4.39e-96	3	812	4	699	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	3.19e-148	2	812	10	824	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|Q4WU49|BGLI_ASPFU	4.03e-147	1	811	4	815	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	4.03e-147	1	811	4	815	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.71e-145	2	811	5	815	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	3.67e-144	1	811	4	815	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998892	0.001129

TMHMM  Annotations     

There is no transmembrane helices in FOXG_11801-t26_1-p1.