CAZyme Information: FOXG_11797-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_11797-t26_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
167		18219.53	6.7392

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000598.1:2449534-2450244(+)

Full Sequence      

MSMISAHDLEGKTVAFVNFATGTAIDLKDGFTSPPDGTPCIGWQAHLNENQQWKCVKYQH
GPDDQPQFRLQNIRASGRAMDIYNGGTSDGTEIVGWQYSGFGGHQLWCIRPVGCFPAHGT
IVKIENIPAGTFVTLQGGSAQYGTRIVGSHGSLNDLRTDQLWILKLI

Enzyme Prediction     

No EC number prediction in FOXG_11797-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404972	RicinB_lectin_2	7.72e-11	8	96	9	89	Ricin-type beta-trefoil lectin domain-like.
404972	RicinB_lectin_2	1.64e-10	50	147	2	87	Ricin-type beta-trefoil lectin domain-like.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60024.1|CBM13	5.38e-126	1	167	1	167
QGI69561.1|CBM13	7.18e-105	1	167	1	152
CCT73945.1|CBM13	7.18e-105	1	167	1	152
QGI86918.1|CBM13	7.18e-105	1	167	1	152
QGJ00449.1|CBM13	7.18e-105	1	167	1	152

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU9_A	1.38e-11	79	165	18	103	MOA-E-64 complex [Marasmius oreades]
2IHO_A	3.54e-11	79	165	18	103	Crystal structure of MOA, a lectin from the mushroom Marasmius oreades in complex with the trisaccharide Gal(1,3)Gal(1,4)GlcNAc [Marasmius oreades],5D61_A MOA-Z-VAD-fmk complex, direct orientation [Marasmius oreades],5D62_A MOA-Z-VAD-fmk complex, inverted orientation [Marasmius oreades],5D63_A MOA-Z-VAD-fmk inhibitor complex, direct/inverted dual orientation [Marasmius oreades],6TSO_AAA Chain AAA, Agglutinin [Marasmius oreades],6TSP_AAA Chain AAA, Agglutinin [Marasmius oreades]
3EF2_A	3.54e-11	79	165	18	103	Structure of the Marasmius oreades mushroom lectin (MOA) in complex with Galalpha(1,3)[Fucalpha(1,2)]Gal and Calcium. [Marasmius oreades],3EF2_B Structure of the Marasmius oreades mushroom lectin (MOA) in complex with Galalpha(1,3)[Fucalpha(1,2)]Gal and Calcium. [Marasmius oreades],3EF2_C Structure of the Marasmius oreades mushroom lectin (MOA) in complex with Galalpha(1,3)[Fucalpha(1,2)]Gal and Calcium. [Marasmius oreades],3EF2_D Structure of the Marasmius oreades mushroom lectin (MOA) in complex with Galalpha(1,3)[Fucalpha(1,2)]Gal and Calcium. [Marasmius oreades],6TSQ_AAA Chain AAA, Agglutinin [Marasmius oreades],6TSR_AAA Chain AAA, Agglutinin [Marasmius oreades]
6TSL_AAA	3.54e-11	79	165	18	103	Chain AAA, Agglutinin [Marasmius oreades]
6TSM_AAA	3.54e-11	79	165	18	103	Chain AAA, Agglutinin [Marasmius oreades]

Swiss-Prot Hits     

FOXG_11797-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000003

TMHMM  Annotations     

There is no transmembrane helices in FOXG_11797-t26_1-p1.