CAZyme Information: FOXG_11560-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_11560-t26_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
290		30287.54	4.3505

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000598.1:1825264-1826290(-)

Full Sequence      

MRPFALSAAVFAATALSQNKGEKTKCADGLYMIAVRGTGEDKGSGRIGEIAEDVSKRVNG
SIVSPLDYPATLQDPDYFDSEEAGVKALSAALDGYHSSCPNGKIAVFGYSQGGQVATDVF
CGGSDNKPLTMSLVKDSVVAVIAFGDPSHVANLTYDRGTSKNDGIFERPSNETKLCEDNY
SDIIRSYCDTGDVYCDVGKNNETHGSYFEKYGKEVVDFVVERYEKALKDESTSTQTSTAA
ATATAETSGSATASDAPSATTAAPGNAAAGLVPGLVLAMIPLALAVSEYL

Enzyme Prediction     

No EC number prediction in FOXG_11560-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	30	222	7.7e-40	0.9682539682539683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	7.05e-39	26	223	1	173	Cutinase.
369775	PE-PPE	2.58e-04	60	148	2	90	PE-PPE domain. This domain is found C terminal to the PE (pfam00934) and PPE (pfam00823) domains. The secondary structure of this domain is predicted to be a mixture of alpha helices and beta strands.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD59797.1|CE5	1.50e-193	1	290	1	290
QGI69293.1|CE5	4.54e-164	1	290	1	295
QGJ00182.1|CE5	4.54e-164	1	290	1	295
QGI86657.1|CE5	4.54e-164	1	290	1	295
CCT73669.1|CE5	4.54e-164	1	290	1	295

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1BS9_A	3.62e-25	30	219	5	202	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	3.62e-25	30	219	5	202	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	5.22e-24	30	219	5	202	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
1QOZ_A	3.84e-23	30	219	5	202	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O59893|AXE2_TALPU	9.07e-25	22	219	25	229	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	2.13e-22	7	219	4	225	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|Q99034|AXE1_HYPJE	1.21e-21	30	219	36	233	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|P0A537|CULP3_MYCBO	1.70e-08	26	222	44	225	Probable carboxylesterase Culp3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=cut3 PE=3 SV=1
sp|P9WP38|CULP3_MYCTO	1.70e-08	26	222	44	225	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=cut3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.954650	0.045375

TMHMM  Annotations     

There is no transmembrane helices in FOXG_11560-t26_1-p1.