CAZyme Information: FOXG_10939-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_10939-t26_1-p1
• CAZy Family: GH2
• CAZyme Description: alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
713		80254.48	6.6208

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000589.1:343056-345197(+)

Full Sequence      

MAHNTIFISWRTTSLTINLTKNELGAICLYEILPLNHCHQKSASRLFASSELPLVSVRLS
GEGNTNDKTAKSLVGGYLSSRLKYKSHQESQDGDVHRLSIHSEDERAGISVTAHLSVHRD
VPVLRSAVTIINESKSSDVIVTQISSLTIGGLTTSSNEWNKDYVLRTSTNSWFREAQWRK
HYLPDIGIDKNGICELPDGHSGSQATFSLQNRGSFSTGSHLPMGILESKENSDTWAWQIE
HNGSWRWEIGDYKDSIYVAAGGPTKADHDWRHTLHPGDSFTTPPVSLTRVSGCFQDAIRA
LNEYRRRIIRPHDDNKRLPIIFNDYMNCLMGDPDEDKIEALLDPVSQSGAEYFVIDAGWY
ADDSNWWDDVGLWEPSKKRFPSGFKTLMEKIKSRGLIPGLWLEPEVVGVRSVVGDRLPED
AFFHENGQRIVERGRFQLDYRHPEVRAWMTKVVDRLVLHYGAGFFKFDYNIEVIQGTDAP
GSSSAGANQLLHQRCYLDWVRSLLDKHPNLVIENCSSGAQRMDYAMLSVHSLQSTSDQQD
PVLYAAIAAALPTCVLPEQSASWAYPQPEWSDELNAFTVVNSLLGRVYLSGRLDHLSPSQ
MELITEGMHAYKTIRQYLVTAHAIWPLGLPRWHDDWISLGLETDNGLYLSVWRRGGSCSK
EIPLPRLAGCGKAQVNVLYPKRLPTQAIWNEGHGILELKLPETRCARVLHITS

Enzyme Prediction     

No EC number prediction in FOXG_10939-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	75	621	1.9e-97	0.7747093023255814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269892	GH36	1.73e-86	317	613	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
307952	Melibiase	1.57e-32	279	587	1	298	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
225882	GalA	9.17e-30	41	542	43	510	Alpha-galactosidase [Carbohydrate transport and metabolism].
269893	GH27	8.97e-09	322	396	5	80	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
407116	Glyco_hydro_36N	2.06e-06	76	177	68	175	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD48422.1|GH36	0.0	1	713	1	713
QGI88848.1|GH36	0.0	1	713	1	713
QGI57937.1|GH36	0.0	1	713	1	713
CCT61505.1|GH36	0.0	1	713	1	713
QGI75155.1|GH36	0.0	1	713	1	708

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XN0_A	1.09e-25	91	616	130	634	Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
2XN2_A	1.44e-25	91	616	130	634	Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with galactose [Lactobacillus acidophilus NCFM]
6PHU_A	1.83e-24	94	615	143	642	SpAga wild type apo structure [Streptococcus pneumoniae TIGR4],6PHV_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4]
6PHW_A	7.43e-24	94	615	143	642	Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PHX_A SpAga D472N structure in complex with raffinose [Streptococcus pneumoniae TIGR4],6PHY_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PI0_A AgaD472N-Linear Blood group B type 2 trisaccharide complex structure [Streptococcus pneumoniae TIGR4]
3MI6_A	4.02e-23	89	616	125	631	Chain A, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_B Chain B, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_C Chain C, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_D Chain D, Alpha-galactosidase [Levilactobacillus brevis ATCC 367]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G1UB44|MELA_LACAC	5.61e-25	91	616	130	634	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
sp|P27756|AGAL_STRMU	5.15e-24	68	615	101	622	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3
sp|P43469|AGAL2_PEDPE	2.09e-23	248	622	260	630	Alpha-galactosidase 2 OS=Pediococcus pentosaceus OX=1255 GN=agaS PE=3 SV=1
sp|Q5ARP5|AGALG_EMENI	6.50e-23	207	645	211	657	Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglG PE=2 SV=1
sp|Q9ALJ4|AGAA_GEOSE	2.47e-21	269	616	279	630	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000079	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FOXG_10939-t26_1-p1.