CAZyme Information: FOXG_10818-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_10818-t26_1-p1
• CAZy Family: GH2
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
860		94798.54	5.5551

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000595.1:4320597-4323451(-)

Full Sequence      

MTNTGMDRSFLTASVEDLVDHMSLAEKVSLIAGEDWWRTVALPRLNIPSVKVTDGPNGAR
GQSFFKMTPAVVLPNATAMAATFSSTLPTEAARLLAAETKARSSVCLLAPTINICRSPLG
GRSFESFGEDPTLSGIIAAEYIKGLQSHGISAAIKHFLANDQEHERMGQDSIIAPRALRQ
IYLRPFQIAQARAAPWSYMTSYNKLNGTHCAEHDWLLKDLLRGEWGFEGLVMSDWMGTYS
VAEAINAGLDLEMPGKPRWRQLQLVRHSINAHKILPETLNERVVTLLRWVQKLSALNPDI
VYGRDDSIEWTRKENQEEDAALVRRIASEGIVLLKNETSTLPIVRGKVAVIGPNAKNGVI
TGGGSARLRSAWRVTPWQGLVDNKPDDIELSYTLGCKGSKFLPVFGEEFTSMDGVTPGFD
MLHYAIADGKQASQPAVSEVWNNSDIMLADFKHPDLGDDYFTEIQALFIAPITGDWQFEV
SVTGQAWVYLDDELVADLSQEQKRTSSFFGNGGNGTIITVAVVKDKVYKFRLLHDSRKPP
LAPGQDSQPLQLIGMKLGSFPVIDEDKAINEAVELAKASDVAVLVVGLDQDWESESYDRP
NLSLPLRLNDLVRRVAVEAPDTKKVVILQTRSAVSMPWLENVDSVIWPWYGGNEAGNAIA
DVVYGKVNPSGRLPITLPKRELDIAANLNFKSARTKTYYEEGIWVGYRHFNARGIEPVYP
FGHGLSYTSFECSDLIVSPSTSASPDEWKISVSAKVTNTGSVPGAHSVHFYTTPPPATSN
SLTHPEVTLQGFNKTAVLLPGGSETVTVEMDKYAISHWDELTSVWRAEPGEWHVQIGTNA
QTMCAKERFTVPRDFKWTGV

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	42	254	2.5e-61	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.09e-68	40	850	97	763	beta-glucosidase BglX.
224389	BglX	2.97e-62	37	367	50	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	6.88e-46	556	727	68	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	2.77e-44	11	794	49	727	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	4.72e-34	40	288	59	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD55271.1|GH3	0.0	1	860	1	860
UKZ91447.1|GH3	0.0	1	860	1	860
CBX93190.1|GH3	0.0	1	860	1	861
AUB23806.1|GH3	0.0	1	860	1	862
AFR94189.2|GH3	0.0	1	860	1	862

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.01e-184	15	860	6	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	4.32e-180	15	860	6	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.54e-113	11	856	1	673	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	2.91e-91	15	854	4	716	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
5WAB_A	2.12e-90	19	856	9	668	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DNN8|BGLJ_NEOFI	4.14e-204	14	860	13	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|Q4WLY1|BGLJ_ASPFU	2.38e-200	14	860	13	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2
sp|B0Y8M8|BGLJ_ASPFC	4.74e-200	14	860	13	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|Q5BA18|BGLK_EMENI	2.58e-198	15	860	13	838	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|B0Y3M6|BGLI_ASPFC	2.55e-195	15	860	6	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000006

TMHMM  Annotations     

There is no transmembrane helices in FOXG_10818-t26_1-p1.