CAZyme Information: FOXG_10683-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_10683-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	CM000595.1|CGC14	41606.54	4.4561

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000595.1:3960708-3961907(-)

Full Sequence      

MASLISTLSILALAATHVFSHVIMVEPHPFNLDTEPLYQTWPLSEDLPFPCQGRTQHPEQ
VTKVTAGKTQLVKFWGSAVHGGGSCQFSVAYGKEPPKDPKKWHTIYSIIGGCPAEAEGNI
ASTGTDPHGRENGNECGNDTGKECTKQFDIPIPKDMQNGPATFAWTWFNKIGNREMYMVC
SPIEVVGGKDDSSYVDTLPAIFRGNIPGECTTGASGSVINFPEPGDFGKIYEQGTPGSEG
TCAKGVEPNFKDDAAAPEPEKPAESGSPAPGQPSAPVPAPEQPFAPVEGAPASPSAPVQP
SAPAPAPVQPSAPAAPSSMVTMPSAPTQPTDAPAPVDSTKPEAGAPAWSGEFQACPSDVK
SGMMHCFSETTWGICNGGWAFVSKVAEGTKCIDGAIAAE

Enzyme Prediction     

No EC number prediction in FOXG_10683-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA11	21	227	6.2e-63	0.9476439790575916

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
237865	PRK14951	1.82e-11	250	343	364	461	DNA polymerase III subunits gamma and tau; Provisional
411490	pneumo_PspA	1.02e-10	253	379	348	472	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
236138	PRK07994	8.12e-10	250	359	359	469	DNA polymerase III subunits gamma and tau; Validated
237865	PRK14951	1.38e-09	236	347	366	484	DNA polymerase III subunits gamma and tau; Provisional
236090	PRK07764	1.66e-09	254	350	403	505	DNA polymerase III subunits gamma and tau; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD55128.1|AA11	2.90e-250	1	399	1	360
CCT69101.1|AA11	1.65e-245	1	399	1	409
QGI65138.1|AA11	8.75e-239	1	399	1	401
QGI96022.1|AA11	8.75e-239	1	399	1	401
QGI82391.1|AA11	8.75e-239	1	399	1	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAH_A	7.20e-35	21	227	1	198	Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Zn [Aspergillus oryzae],4MAI_A Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Cu(I) [Aspergillus oryzae]

Swiss-Prot Hits     

FOXG_10683-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000258	0.999693	CS pos: 20-21. Pr: 0.9708

TMHMM  Annotations     

There is no transmembrane helices in FOXG_10683-t26_1-p1.