CAZyme Information: FOXG_10183-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_10183-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386		43975.13	4.2112

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000599.1:2152761-2154020(+)

Full Sequence      

MENMLRPLMRSLVTMLIGAECGLAYLTEMADTMIAKGVKPDLGYQDAVLYLGFEKAYELS
GDQKYLDWYIGQIDGPVVQEDGSIKGLNTSRYILDEYRMGHNYLYLYKQTGEPKYETAAN
TVRRMLDSYPRTPSGGFWHQQFFRDQMWLDGIYMADSFYARWTHLYDSDNDTAWDDILLQ
YELIHENTINETTGLHVHGWVEGEASWADPETGRAPNVWGRALGWYFMALVEVLQYFPTS
HSGYDQLLGYLESVAKGLKASRDPDLGSWWQVMNEPYPKREGNFIESSGSSMFTWGLLKA
VDLGYLDSDEYLETAKDAFTSLIDNFVTEGEDGSLILNSTVAECGLTSSNVTFEYYVSRP
KLENGQNGVGPFMLASYEWESWAKDA

Enzyme Prediction     

No EC number prediction in FOXG_10183-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	38	380	4.2e-95	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	2.12e-69	24	380	14	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	2.96e-68	32	380	17	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60262.1|GH105	3.93e-292	1	386	1	386
CCT75065.1|GH105	2.22e-276	7	386	10	389
QGI70454.1|GH105	2.29e-274	7	386	10	391
QGI87812.1|GH105	2.29e-274	7	386	10	391
QGJ01344.1|GH105	2.29e-274	7	386	10	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	4.36e-81	25	381	4	360	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.02e-53	17	386	8	371	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.19e-52	23	386	4	361	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]
5NOA_A	6.50e-11	44	378	56	370	Polysaccharide Lyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.43e-08	44	378	39	353	Chain A, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	5.23e-53	17	386	8	371	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	5.96e-22	194	378	38	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	5.96e-22	194	378	38	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
sp|P9WF04|UH105_ALTSL	1.48e-06	47	330	95	373	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.993697	0.006304

TMHMM  Annotations     

There is no transmembrane helices in FOXG_10183-t26_1-p1.