CAZyme Information: FOXG_10148-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_10148-t26_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
740		82299.55	4.8266

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000599.1:2071793-2074283(-)

Full Sequence      

MAASQTAIELISQLTVEEKVSLLSAVDWWRTPTIKRDDVFIPHIKTSDGPNGARGESYVS
GITAACFPCSTAIGATFDSEQAYRLGKEIAKETKTKSANVLLAPTMNIIRSPLGGRNYET
YSEDPYLIGTLASAFVRGCQSEGIAATPKHFVANDSEKSRTEMTSNIDRQTLREIYMLPF
QLVMRDSDPWCFMTSYNRLNGEYSAEDHWVIELARKTGRFEDPVEKPERSVKDPERLEFI
TSIAADGMVLLKNDNNILPLPSNASVAVIGHHALHPSIGGGGSAKVLAQHIISPLEGPKA
QGANCRHAPGVPVFGALPHAEPETISPVQLRWFNSLVVGENLAHEQTITLPEYMIKEAWP
TYLEKEYCTNMSFTLRPTTSGSHVFSVITTGKADVLVNGDNVFHRQQEPVLLPESFYFYK
AKIERRFTLDMTAGQEYKIELHSWATDPEVLSEIGGTMFQGTSLRFMEHVDIPGAIQHAA
EIAASSDVAVVFVGTTNELESEGYDRDTMDLTSDQYDLINAVVARNPLTVVVNLSGSPVT
VSPFIDQVSCFLQAWFAGQECGHAIARVLLGHVNPMSWPKRKEDNPAYGNFPCDDNLELN
YEERLKVGYRFYDDETAPKPQFHFGEGLSYTTFELTGQENTSSRFDSTETAETSLVTEVK
NTGVRDVKDLRSYCKVFVSAGQTEEVTFNLDKYAFSYFDTAVDKWKMPQGEFRLHICFSS
AETLQTVSVTNPETRYWTGL

Enzyme Prediction     

No EC number prediction in FOXG_10148-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	40	221	2.4e-48	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396478	Glyco_hydro_3_C	2.35e-43	248	609	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	1.04e-38	41	313	60	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	3.76e-36	67	725	120	759	beta-glucosidase BglX.
395747	Glyco_hydro_3	7.54e-24	67	224	88	251	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	9.12e-24	4	633	50	636	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60297.1|GH3	0.0	1	740	1	834
QGI87776.1|GH3	0.0	10	740	7	831
QGJ01306.1|GH3	0.0	10	740	7	831
CCT75026.1|GH3	0.0	10	740	7	831
QGI70417.1|GH3	0.0	10	740	7	831

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	6.70e-122	9	740	8	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.92e-119	9	740	8	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.65e-85	9	729	7	666	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.60e-75	4	730	2	662	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	1.18e-65	7	729	54	826	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y3M6|BGLI_ASPFC	1.30e-123	11	740	10	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	1.30e-123	11	740	10	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|Q5BFG8|BGLB_EMENI	2.16e-123	10	716	14	823	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|A1CA51|BGLI_ASPCL	5.02e-123	11	740	10	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	1.99e-122	11	740	10	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999894	0.000137

TMHMM  Annotations     

There is no transmembrane helices in FOXG_10148-t26_1-p1.