CAZyme Information: FOXG_10041-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_10041-t26_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410		47009.35	8.1385

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000599.1:1789761-1791141(+)

Full Sequence      

MHLKLALPLFLAVAEAWTPQSRAAAKANGEKITERWLPNDDKIRGVNLGSQFIIERWMAE
ESWKNMGCSAYNDEWACVKGIGQDKANAAFKKHWETWITEDDIKQIASLGLNAVRIPVGY
WMYEDIIQKGEYWPRGGIWHLDRIVGWCKKHGIYAVIGLHSAPGISSPNEQFTGHSIPNP
GFYTAENYERAFKFLEWMTKRIHTNGNYTTVGMLEVLNEPVRAGKWKAEADDMIKNYYPG
AYKRIQAMEGYLKVPKADRLHIQYMGKSWGAGDPRQYLPDDDLIFFDAHRYLSFDNRIAG
NKKAYIQTACKDNMGQHVFVGEWSLSVNSTLKNTDEFKIEGQETWYKAYWAAQAESFEKS
DGWFFWSWKCDGDLGKKDWRWCYQAAVAAGVIPKDASKAKSLSPCARYTN

Enzyme Prediction     

EC	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	82	384	1.5e-142	0.9966666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.16e-18	26	363	2	325	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	8.78e-12	95	368	22	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60398.1|GH5_15	0.0	1	410	1	410
CCT74918.1|GH5_15	0.0	1	409	1	409
QGI70318.1|GH5_15	1.88e-310	1	406	1	406
QGJ01207.1|GH5_15	1.88e-310	1	406	1	406
QPC76097.1|GH5_15	1.32e-286	10	408	10	408

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	4.45e-34	36	405	2	391	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	1.62e-33	36	405	2	391	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	1.79e-33	36	405	8	397	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	2.44e-33	36	405	7	396	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PBO_A	4.72e-33	36	405	8	397	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B6Q3|EXGB_EMENI	5.71e-132	3	405	1	409	Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgB PE=2 SV=1
sp|A1DGM6|EXGB_NEOFI	1.25e-123	6	405	7	399	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|Q2TZQ9|EXGB_ASPOR	9.89e-122	16	395	18	391	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgB PE=3 SV=1
sp|Q0C8Z0|EXGB_ASPTN	1.31e-121	16	405	20	403	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1
sp|B8NBJ4|EXGB_ASPFN	7.51e-118	16	390	18	386	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000293	0.999695	CS pos: 16-17. Pr: 0.9467

TMHMM  Annotations     

There is no transmembrane helices in FOXG_10041-t26_1-p1.