CAZyme Information: FOXG_09745-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_09745-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400		43907.27	4.8373

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000599.1:1010272-1011572(+)

Full Sequence      

MRLVKPLVFCPKGLWEQMGTIGISRGRSWVLLWTIGQLTGDKTYNKLVTEGIQWQVGKGK
DFMPANNTASMGNDDQSIWAFAALTAAEYGYPEPSEGQPEWLDLAVAVWEEQRARWDTEV
AQKTCNGGLRWQIMMTNAGFDYKSTLANVLFFNLGARLARLTSNETYADYASKTWDWLET
SELIDKETWAVYDGAQATEGTKNCSNVNQIQWSANSAGLTMGAAFMYNFTEGSDEWRKRT
ENLASATLETFFKKNGDFNEIACANSKGKCPRDIVMYKGFTHRWLAVATQVAPFTASSIL
PVLRKSAEGLKAEGNGGDALEQKFSNFVVVSNLLIDDSSAPGHQNETGKTDKAEDSPSST
STPVSKSSSAEAEGNSAIKLTGSSSFLALSVLIMASQWIL

Enzyme Prediction     

No EC number prediction in FOXG_09745-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	32	325	2.9e-66	0.7458100558659218

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	3.75e-110	37	309	50	312	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60681.1|GH76	1.41e-265	37	400	85	448
CCT74640.1|GH76	4.36e-243	37	400	85	445
QGI70057.1|GH76	2.52e-242	37	400	85	445
QGJ00947.1|GH76	2.52e-242	37	400	85	445
QGI87419.1|GH76	5.08e-242	37	400	85	445

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	2.22e-91	38	308	92	354	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74556|YCZ2_SCHPO	1.96e-67	8	317	56	347	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q9P6I3|YHG7_SCHPO	9.23e-60	39	317	73	342	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2
sp|P36091|DCW1_YEAST	1.09e-59	26	317	69	350	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	5.86e-58	26	317	66	347	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q05031|DFG5_YEAST	1.08e-57	38	354	86	411	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000020	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FOXG_09745-t26_1-p1.