CAZyme Information: FOXG_09205-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_09205-t26_1-p1
• CAZy Family: GH132
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
276		31004.13	7.5864

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000597.1:957694-958665(+)

Full Sequence      

MHFFQKPALLLLPAAALAGAIPYEVRKDFANPKSGITLKKAFDIHAQEENGFLSYKGTQP
GKVVQDGVKLRDSFYGNGYRKRLRKDLSGNEIVWAGTEKTKGNMKDGHFAAWSGKTVQYI
NDHVDPSLEQRPNLILIHAGTNDMNSNHRVSTDGNHPQETTNRLKSMVEKMISKCPDATI
IIGMITDVCDNKSYHFQRERTKIYRGHIAKLAAELSKDGSHVLAADFGPFDDTLLSDCVH
PTQKGYEILGDWWYDFIHQIPEGWIKDPVGPDPVRD

Enzyme Prediction     

No EC number prediction in FOXG_09205-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	76	257	1.1e-34	0.9123711340206185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.73e-36	100	257	11	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	3.37e-18	109	248	38	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	6.88e-14	110	256	41	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
395531	Lipase_GDSL	1.13e-09	117	253	64	224	GDSL-like Lipase/Acylhydrolase.
225353	TesA	1.11e-06	53	260	1	211	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT71135.1|CE0	5.06e-162	1	276	1	305
QGI66858.1|CE0	5.06e-162	1	276	1	305
CEF83009.1|CE0	2.41e-82	50	273	28	262
QPC73171.1|CE0	2.67e-81	50	273	28	262
QPC64279.1|CE0	1.11e-74	50	273	28	262

PDB Hits     

FOXG_09205-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

FOXG_09205-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000394	0.999608	CS pos: 20-21. Pr: 0.8964

TMHMM  Annotations     

There is no transmembrane helices in FOXG_09205-t26_1-p1.