CAZyme Information: FOXG_08873-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_08873-t26_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
539	CM000597.1|CGC15	57943.81	4.9592

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000597.1:46476-48457(+)

Full Sequence      

MRPTNILAAVSAVASVVGAVDLTGYEYVVVGSGAGGGPLAARLALAGHKTLLIDAGDDQG
QSLNYTVPAYSARASEDEDIAWNFFVRHYADDKRQAQDYKTTYETPDGGEYTGLDPPKGS
TIKGTLYPRTATIGGCTAHNALIALYPWKSDFEYIASLTGDTSWSADNMRKYFVRLEDNN
YLLPGKPGHVVFDKSEDPPRATGVEFLDGRGIYKASPLSRSAGAGKPGSATASREVIVAG
GTYNSPQILKLSGIGPADELKKFNIPVISDLPGVGTNLQDHYEIVVQSRIPKNFSALHGC
TFDGGPDDKCLDQWQKPLLGLTANKGTYTSSGLPVAMLYKSTAADRGDWDIFAFGGPVNF
RGYFPNYSYNATAEHDIFSWAILKGQPRNHAGTVTLKSDDPLDVPEIVYNYFDTGDDGYE
KDIQALAEAVDLTRDAFDRQIIPTKEVLPGASVSTKGEVEDYIKNTAWGHHASCTCPIGA
ADDEMAVLDSKFRVRGVKGLRVVDASVYPRIPGTFTAVSTFIVAEKAADDILSGLSRLS

Enzyme Prediction     

No EC number prediction in FOXG_08873-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	24	532	3.3e-70	0.5

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.86e-66	190	532	227	532	choline dehydrogenase; Validated
225186	BetA	1.74e-45	39	533	22	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.34e-31	392	527	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.80e-16	190	514	246	559	Protein HOTHEAD
366272	GMC_oxred_N	5.95e-11	199	283	160	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57933.1|AA3	0.0	1	539	1	649
UPK92349.1|AA3	0.0	1	536	1	646
QMW33146.1|AA3	1.05e-265	19	536	19	646
QRD84722.1|AA3	1.05e-265	19	536	19	646
QMW45179.1|AA3	1.05e-265	19	536	19	646

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	4.17e-31	161	528	193	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	5.62e-31	161	528	193	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6ZH7_A	5.62e-31	161	528	193	557	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	5.62e-31	161	528	193	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	6.25e-31	161	528	209	573	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7MF12|BETA_VIBVY	6.68e-41	25	532	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q8D3K2|BETA_VIBVU	4.41e-40	25	532	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q985M5|BETA_RHILO	2.56e-39	26	532	5	527	Oxygen-dependent choline dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=betA PE=3 SV=1
sp|B2K8U4|BETA_YERPB	4.32e-39	25	531	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=betA PE=3 SV=1
sp|Q66D54|BETA_YERPS	4.32e-39	25	531	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.085691	0.914283	CS pos: 19-20. Pr: 0.7706

TMHMM  Annotations     

There is no transmembrane helices in FOXG_08873-t26_1-p1.