CAZyme Information: FOXG_08415-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_08415-t26_1-p1
• CAZy Family: GH128
• CAZyme Description: dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414		47421.14	9.8396

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000590.1:3372961-3374408(-)

Full Sequence      

MPESASGTLSQGVRFLRNVLNGRHALSKLIPIALWLVDALGCGLIIWKIPYTEIDWVAYM
QQISQFVSGERDYTKMEGDTGPLVYPAAHVYTYTGLYYITDKGTNILLAQQIFAVLYMAT
LAVVMLCYWKAKVPPYMFIFLIASKRLHSLFVLRCFNDCFAVFFLWLTIFLFQRRQWTVG
SLVYSWGLGIKMSLLLVLPAIGVILFLGRGLWPSLRLAWLMAQIQFAIGLPFITKNPRGY
AARAFELSRQFQFKWTVNWRMLGEEVFLSKYFALSLLACHILVLLIFISKRWIQPTGRSL
YDLIPSFLRLKSPFTMQEQLRISHYVTPEYAMTTMLTANLIGLLFARSLHYQFYAYLAWA
TPYLLWRATEDPVIVAIIWAAQEWAWNVYPSTTSAQPSAVKRAVPATAAQVGDV

Enzyme Prediction     

EC	2.4.1.258:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	33	394	1.8e-145	0.9862637362637363

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	0.0	32	393	1	355	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD52612.1|GT58	2.22e-285	1	414	378	806
CCT63973.1|GT58	2.10e-281	1	414	1	429
QGI91167.1|GT58	1.64e-275	1	414	378	806
QGI77460.1|GT58	1.64e-275	1	414	378	806
QGI60262.1|GT58	1.64e-275	1	414	378	806

PDB Hits     

FOXG_08415-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9C1K8|ALG3_NEUCR	3.30e-182	2	392	8	400	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alg-3 PE=3 SV=1
sp|Q2U6A4|ALG3_ASPOR	5.80e-139	20	394	12	375	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alg3 PE=3 SV=1
sp|Q4WVG2|ALG3_ASPFU	1.52e-135	20	394	20	383	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=alg3 PE=3 SV=1
sp|A1CBE6|ALG3_ASPCL	9.10e-132	20	392	74	435	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=alg3 PE=3 SV=1
sp|A1DDZ3|ALG3_NEOFI	1.14e-130	20	394	12	375	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=alg3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000009

TMHMM  Annotations     

Start	End
29	51
106	128
150	172
185	207
217	234
266	288