CAZyme Information: FOXG_06755-t26_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOXG_06755-t26_1-p1
• CAZy Family: CE5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
945		104232.70	8.9298

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporum4287	21354	426428	429	20925

• Gene Location: location=CM000591.1:3772102-3774994(-)

Full Sequence      

MVFSLTESNGLGNITIKDADSQNITSGNVQADGRVKVQFHQHAQSVVSWFKGCQSRAVPT
EPFKKRSCNTVSLNSQQLVTTPRLNIAIHIIGSRGDVQPFIPVAQALSRPPYSHRVRICT
HPVFKHFIESQGIEFFSIGGDPEALMAYMVKNPGLLPSRKSVKAGEIKKRREEMWEILIG
AWRSCIEAGDGMGDRVMAANVRETKDLFIADAIIANPPSMAHIHCAEKLGIPLHMVFTMP
WSPTERFSHPLASMTYRGSTDGAVANYLSYIVMELLTWQGLGDLINRFRTRILCLDSISP
LWGYQLLTRLRVPYSYLWSQSLIPKPSDWGSHINITGFSFLSLANHYMPTPDLVGFLEKG
PPPIYIGFGSIVIEDPPALTQLIFDAVKLAGVRAIISRGWGGIGRGDIPETICLIGDCPH
DWLFQRVSAVVHHGGAGTTAAGIAAGRPTVIVPFFGDQPFWGQMIAQAGAGPTPIPFKEL
TAEILASSIIFSLKTEVQEAVQKMAERIGAEDGACGTAVDFQERLDIDHLRCDICPDRLA
VWRHKTTGTHLSGFAAACLVDKGLLDPRDFKLLKHKHWYVDEGAEHPIVGAVAAASNFVI
TLGTAASDFSQRLKNRPRWSSRDNKAILPQMSWYNTNRDIHQPTLTVNHNEDHDVSSTAR
EAHQGPPPNTNGNGMTIAELTNPTHNGILKDSIRLAPTELENFAHKMATKSLLTGEIPTP
ETKRVPTLHERRKATWKAQEQGPRGHMFYIMHITGRFAADVAKAGLKVPVALVYNVANGF
HNYPSYTSNAVEVRQRNEITGLGSGACTAGREFVLGLWDAFSGVVIKPYQGAKAEAGKGF
GKGMWNGTLGFVYNLGAGKYSIHIPLLRKQISFLYKDQRLISLAIFGLLGYTLKGIEKEF
SKHHLTSLKAEILLIRLRQGIDDFSQATPEGKEMVVERWRCLQSQ

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	205	518	1.6e-54	0.743455497382199

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.80e-60	84	525	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	5.76e-29	86	514	4	388	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	3.11e-17	86	244	1	135	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	0.001	358	525	222	389	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAD00894.3|GT1	0.0	4	944	2	910
UPK91708.1|GT1	0.0	1	942	1	883
QKD55584.1|GT1	0.0	1	942	1	889
QGI82773.1|GT1	0.0	1	942	1	889
QGI65525.1|GT1	0.0	1	942	1	889

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	4.98e-68	91	513	27	427	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	8.21e-68	91	513	47	447	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
3H4I_A	1.38e-30	84	540	1	394	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1IIR_A	2.59e-28	84	514	1	388	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
1RRV_A	4.71e-23	84	518	1	392	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	4.33e-129	61	525	132	574	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	5.07e-121	64	525	173	610	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|A0A2Z4HPY4|EFUA_HORCR	2.06e-75	65	578	678	1181	Enfumafungin synthase efuA OS=Hormonema carpetanum OX=284138 GN=efuA PE=3 SV=1
sp|Q54IL5|UGT52_DICDI	4.41e-74	72	524	1152	1607	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|Q9Y751|ATG26_KOMPG	1.66e-72	74	513	751	1166	Sterol 3-beta-glucosyltransferase OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999700	0.000325

TMHMM  Annotations     

There is no transmembrane helices in FOXG_06755-t26_1-p1.